KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0057Help
Entry
LLKF_0057         CDS       T01141                                 

Gene name
yaiA
Definition
(GenBank) Glyoxalase family protein
  KO
K15975  glyoxalase family protein
Organism
llk  Lactococcus lactis subsp. lactis KF147
Brite
KEGG Orthology (KO) [BR:llk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99999 Others
    LLKF_0057 (yaiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase
Motif
Other DBs
NCBI-ProteinID: ADA63906
UniProt: D2BLV5
LinkDB All DBs
Position
63802..64971
Genome map
AA seq 389 aa AA seqDB search
MAELTKIETKIPENLTLGGVHHVTAITSSAQKIYDFFTNILGLRLAKLTVNQDDYETYHL
FFTEEDGHGADMTFFDFKDIPKGNHGVNNIERASFRVPTDASLDYWTRRFDNAHVKHGEI
SSKFGQKTLEFEDFDGQLYQLISDQNNSGDDSKGRSWQLSNVPQEHGITGLGPVFVKVEN
AENLRTILETVFGFRYAGQEADLHLFEVANGGNGAALILQEAGEKEAYAYQGYGTIHHLA
LGTTNPETLNYWIERIKAFRLPHSGLVDRFYFSSEYVRVAPGVLFEIATYTPGIGALDMA
KSGLGAVDSYEEALITSGFWIDQTKEESGLSLSLPPHLFPGDEATKARTAASLRPLDTSD
AHRDRTKDELWTVEKVLEHKAGTPDETVQ
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggctgaattaacaaaaattgaaacaaaaatacctgaaaatcttactcttggtggtgtt
caccacgtaacagcaatcacctcaagtgctcaaaaaatctatgattttttcacaaatatc
ttgggtctgcgtttagcaaaattaacagtcaatcaagatgactatgaaacttatcacctc
tttttcacagaagaagatgggcatggagctgatatgactttctttgatttcaaagatatt
cctaaaggaaatcatggagttaataatattgaacgtgcttcatttcgtgtaccgacagat
gcgtccttagattattggactcgtcgttttgacaatgcccatgttaaacatggcgaaatt
tctagtaaatttggtcaaaaaaccttagagtttgaagattttgatggtcaattgtatcaa
ttgatttctgaccaaaataatagtggggatgattcaaaaggacgttcttggcaactttct
aatgttccgcaagaacatggaattactggacttggccctgtttttgtaaaagttgaaaat
gccgaaaatcttcggaccattttggaaacagtttttggcttccgttacgctgggcaagaa
gctgatttacatctttttgaagtggcgaatggtggaaatggagcagctttgattcttcaa
gaagctggtgaaaaagaagcttacgcttatcaaggttatggtacgattcatcatttagct
ctgggaacaacaaatcctgaaactttaaactattggattgaacgcattaaggctttccgt
ttgccacattctggtttggttgaccgtttctatttctcaagtgaatatgtcagagtagca
ccaggagttctctttgaaattgcgacttacacaccagggattggggcattggacatggca
aaatcaggtctaggagccgttgattcttatgaagaagctctaattacttctggtttctgg
attgaccaaactaaggaagaatcaggtttatctttgagcttacctcctcatttattcccc
ggagatgaagctactaaagcgagaacagccgcaagtttacgtccattggacacttcagat
gctcatcgtgaccgcacaaaagatgaactatggactgttgaaaaagtattggaacacaaa
gctggaactccggatgaaacagtgcaataa

DBGET integrated database retrieval system