KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0153Help
Entry
LLKF_0153         CDS       T01141                                 

Gene name
aspC
Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00220  Arginine biosynthesis
llk00250  Alanine, aspartate and glutamate metabolism
llk00290  Valine, leucine and isoleucine biosynthesis
llk01100  Metabolic pathways
llk01110  Biosynthesis of secondary metabolites
llk01130  Biosynthesis of antibiotics
llk01210  2-Oxocarboxylic acid metabolism
llk01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:llk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LLKF_0153 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    LLKF_0153 (aspC)
   00220 Arginine biosynthesis
    LLKF_0153 (aspC)
Enzymes [BR:llk01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LLKF_0153 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     LLKF_0153 (aspC)
Amino acid related enzymes [BR:llk01007]
 Aminotransferase (transaminase)
  Class I
   LLKF_0153 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABX75699
UniProt: A9QSL3
LinkDB All DBs
Position
154839..156053
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVISDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYFCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWKEPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatttgaaaaatcgcataaacttgataatgtcagctatgatattcgtggtcca
gtattggatgaagcacaaagaatgcgagccaatggtgaaaaaattcttcgattgaataca
ggaaatccagctgaatttggctttcttgctcctgatgaagtcattagtgacttgattcaa
catgctgtggatagcgaaggatattcagattctaaagggattttctcggctcgtaaagcg
attatgcaatactgtcagctcaagggttttcctaatcttgatatcaatgatattttcaca
ggtaatggggtttctgaattgattgttatggccatgcagggacttttggacacaggggat
gaggttttgattcctatgcctgattatccactttggacggcttccgtcagcttagctgga
ggaacagctgttcattacttctgtgatgaacaggctggttggttccctgacattgatgat
attcgctcaaaaatcacaagtaatacaaaagccattgttttgattaatcctaataatcca
acgggtgcgctgtattctaaagatttattgcttgaaattgttcaagtggctagagaaaat
aatttaattattttctctgacgaaatttatgaccgattggttatggatggagcagttcat
gttccgattgctagcttggcaccagatctttttgtggtcacaatgaatggcctctcaaaa
tcacaccgcattgcgggattccgcgtggggtggatggttctgtcaggtgaaaaatcacat
gtcaagggttatattgaaggtttgaatatgctggcttcaatgcgactttgttccaatgtt
ttagctcaatcagtcgtacaaacttcacttggtggcactcaatcagttgataaattgctg
ttgccgggtggacgagtttatgagcaaagagaattcatttataaagccatcaatgatatt
ccaggattatctgcggtcaaacctcaagcagctttctatattttccctaaaattgacaga
gaaatgtataaaattgataatgatgaacaatttgtcttggactttttgaagcaggaaaaa
atcctgcttgttcatggtcgaggatttaattggaaagagccagaccatttccgaattgtt
tatctgcctcgtgtggacgaattagcggaaatacaagaaaaaatggaacgtttcctttgg
caatatcgtaaataa

DBGET integrated database retrieval system