KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0254
Entry
LLKF_0254         CDS       T01141                                 

Gene name
ycfF
Definition
(GenBank) NAD(FAD)-utilizing dehydrogenase
Organism
llk  Lactococcus lactis subsp. lactis KF147
SSDB
Motif
Pfam: HI0933_like FAD_binding_2 GIDA FAD_oxidored Pyr_redox_2 NAD_binding_8 DAO FAD_binding_3 Thi4 AlaDh_PNT_C Pyr_redox_3 Pyr_redox 3HCDH_N FbpA NAD_binding_9 Lycopene_cycl UDPG_MGDP_dh_N NAD_binding_7 Trp_halogenase Ribosomal_S13
Other DBs
NCBI-ProteinID: ADA64036
UniProt: D2BML3
LinkDB
Position
complement(252805..254082)
AA seq 425 aa
MTKSAKTFDVIVVGAGPSGMMAAISAAQNGAKVALIDKNKKVGKKLLMTGGGRCNVTNAR
SVDEILTNVPGNGRFLHSAFSQFSNLDIIEFFESNGVKLKEEDHGRMFPITDKSKTIVDA
LFNKILSLHVSYFPSQAVDKLLIENGAVIGLETDSESFLSPTIILSTGGRAYPSTGSTGD
GYRLARSAGHSISQLYATESALISDEPFILDKSLQGISLREIKLSVLNSKGKAIISHQHD
LLFTHFGISGPAALRCSSFINQLLAKGEKMVTVSLDQFSEKKLGSLKNELTSLSKTDKSI
KNAFSGLTQERMLLFILEKAGIDPSLSAKTLSEQQIDKIASLFKNWQITISKTLPIEKSF
VTGGGVSLKEINPKSMESKQTQGLFMTGELLDINGYTGGYNITCAFVTGFVAGKHAAQIA
SYFQQ
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgacaaaatcagctaaaacatttgacgttattgttgttggcgcaggcccttctggaatg
atggctgccatctcagccgcgcaaaacggagcaaaagttgctcttattgataaaaataaa
aaagtcggaaaaaaattattaatgacaggtggcggacgctgtaatgtgacaaatgcccgt
tctgttgacgaaatattaacaaatgttcctggaaatggtcgttttcttcattcagccttt
tctcaattttctaaccttgatattatcgaattttttgaaagcaatggtgttaaattaaaa
gaagaagaccacgggcgcatgttccctataaccgacaaatcaaaaacaattgttgatgcc
ctcttcaataaaattttgagcctccatgtttcttattttccaagccaagcggttgataag
cttctcattgaaaacggagcggtaattggtcttgaaacggatagcgagagctttttaagc
cctacaattatcctctcaacaggcggacgcgcttatccttccacaggttcaactggtgat
ggctatcgtttagcacgctcagcagggcatagtatttcacaactctatgccactgaatct
gccctgatttctgacgaaccattcattttagacaaaagtcttcaaggcatttccctacgc
gaaatcaaactctcagtactcaattctaagggaaaagcaatcatctctcatcagcatgat
ttattatttacgcatttcggaatttctggtccagctgctctgcgttgttcaagtttcatt
aaccaacttcttgctaaaggtgaaaaaatggtcacagtcagcttagaccaattctccgaa
aaaaagttgggctctttgaaaaatgaactgactagcctttctaaaacagataaatcaatt
aaaaatgccttctcaggattgacccaagaacgtatgcttctatttatccttgaaaaagct
ggaattgaccctagtctttctgccaagacgctatctgagcagcaaattgataaaatcgct
agtcttttcaaaaattggcaaatcacaattagcaaaactttaccaattgagaaatctttt
gtaacaggtggcggtgtttctctcaaagaaataaatcctaaaagtatggagagtaaacaa
acccaaggtttattcatgaccggtgaacttttagatattaatggatacactggcggttat
aatattacctgcgcctttgtgacaggttttgttgctgggaaacacgctgcccaaatcgca
tcttatttccaacaataa

DBGET integrated database retrieval system