KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0393Help
Entry
LLKF_0393         CDS       T01141                                 

Gene name
ahpF
Definition
(GenBank) Peroxiredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Brite
KEGG Orthology (KO) [BR:llk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LLKF_0393 (ahpF)
Enzymes [BR:llk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LLKF_0393 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 FAD_binding_3 Thi4 DAO AlaDh_PNT_C Glutaredoxin NAD_binding_8 K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADA64163
UniProt: D2BNA1
LinkDB All DBs
Position
382965..384494
Genome map
AA seq 509 aa AA seqDB search
MILDETLRAQLMPYMDLLENPIILKVDADLESENGKKIVEFTDELASLSEMISKETAKLN
RKTAFSIEREGVSGVLFSGLPLGHELNSLVLALVQVSGRPPRIEQELVERIQAIQNPLHF
ETYVSLTCHNCPDVVQALNTMSILNPNISHTMIEGGMFQEEVEAKGIMAVPTVFKNGEEF
HNGRASLEELLEKITGPESSKAFSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGLIAER
FGGQPLETLGIENLIGTPYVEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDLIEVSLE
NGALLKSKSVIISTGARWRDLGIPGEQEFKTKGVAYCPHCDGPLFAGKDVAVIGGGNSGI
EAAIDLAGLVRHVTVLEFLPELKADKILQEKLATLNNVTVLTNVETKEILGDDKVRGLNY
QVRGSKEIVHLELAGVFVLIGLVPNTQWLEGTIDLSARGEILTDKVGATNLPGVFAAGDC
TDSVYKQIIISMGTGATASLGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaaactcttcgtgctcagttgatgccttatatggatttgttggaaaat
ccaattattttaaaagttgatgcagatttagagagcgaaaatgggaaaaaaatagtagaa
tttacagatgaacttgcaagtttgtccgaaatgatttcaaaagaaacagcaaaactcaat
cgaaaaacagctttctctattgaaagagaaggtgtttctggagtccttttttcagggcta
ccattaggtcatgagttgaattcattggtcttggcgcttgtccaagtaagtggacgccct
ccacggattgaacaagaattagttgagcgaattcaagcgattcaaaatccacttcacttt
gaaacttatgtgagtttaacttgtcataactgtccagatgttgtccaagcattaaacaca
atgagtattctcaaccccaatattagtcacacaatgattgaggggggaatgtttcaagaa
gaagtggaagcaaaaggaattatggcggttccaactgttttcaaaaatggtgaagaattt
cataatggacgagctagtcttgaagaattactagaaaaaattactggtccagagagttcg
aaagctttttctgataaagacccttatgatgttttagttgttggtggaggccctgctggt
gcaagtgcagctatttatgctgcacgtaaagggattcggacaggtttaatcgctgaacgc
tttggcggtcaaccactagaaactttaggaattgaaaacctcattggaactccttatgtt
gaaggggttcaacttggtcgtcagcttgaagaacatgtgaaaaaatatcctgtcgatttg
atgaacttgcaaaaagcagttaagctagagaaaaaagatttgattgaggtgagtcttgaa
aatggggcacttctaaaaagtaagtcagtcattatttcaacgggcgctcgttggcgagat
ttgggaattccaggagagcaagaatttaaaacaaaaggagtcgcttactgtccacattgt
gatggtcctttgtttgcaggaaaagatgtagcggttatcggtggcggaaattcaggaatc
gaagcagctattgatttagctggtttggttagacatgttactgttcttgaatttttacct
gaacttaaagcagacaaaattttacaagaaaaacttgcgaccctaaataatgttactgtc
ctcaccaatgtagaaacaaaagagattttaggagatgacaaggttagaggtttgaattat
caagttcgtggctctaaagaaattgttcatttggaacttgctggtgtctttgtattaatt
ggtttagttccgaatactcagtggttggagggaacaattgacttatccgcgcgtggagaa
attttgactgataaagttggagcgacaaatcttcctggtgtttttgcagcgggagattgt
acggatagtgtttataagcaaattattatttcaatggggactggggcgaccgcttctcta
ggtgcttttgattatttaataagaaactaa

DBGET integrated database retrieval system