KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0969
Entry
LLKF_0969         CDS       T01141                                 

Gene name
trxB
Definition
(GenBank) Thioredoxin-disulfide reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:llk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LLKF_0969 (trxB)
Enzymes [BR:llk01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     LLKF_0969 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO FAD_oxidored GIDA FAD_binding_2 Thi4 HI0933_like NAD_binding_8 FAD_binding_3 NAD_binding_7 K_oxygenase Lycopene_cycl Shikimate_DH Trp_halogenase
Other DBs
NCBI-ProteinID: ADA64674
UniProt: D2BQ49
LinkDB
Structure
PDB: 

Position
1002302..1003228
AA seq 308 aa
MTEKKYDVVIIGSGPAGMTAAMYTARSEMKTLLLERGVPGGQMNNTAEIENYPGYETIMG
PELSMKMAEPLEGLGVENAYGFVTSIEDHGDYKKIITEDDEFVTKSIIIATGANHRKLEI
PGEEEYGARGVSYCAVCDGAFFRNQEILVIGGGDSAVEEALYLTRFGQSVTIMHRRDKLR
AQEIIQQRAFKEEKINFIWDSVPMEIKGDDKKVQSVVYKNVKTGEVTEKAFGGIFIYVGL
DPVAEFAGNLGITDEAGWIITDDHMRTSLPGIFAVGDVRQKDFRQITTAIGDGAQAAQEA
YKFVAELD
NT seq 927 nt   +upstreamnt  +downstreamnt
atgacagaaaagaaatatgatgttgtcatcattggttcaggccctgcgggaatgactgca
gcgatgtatactgcacgttctgaaatgaaaactttgcttttagaacgtggtgttcctggt
ggtcaaatgaataacacagctgagattgaaaattatcctggctatgaaacaatcatgggt
cctgaactttcaatgaaaatggctgaacctttggaaggtttaggcgtagaaaatgcttat
ggttttgtgacgtctattgaagaccatggggattacaaaaaaattatcacagaagatgat
gagtttgtcactaaatcaattattattgcgacaggagctaatcaccgtaagcttgaaatt
cccggtgaggaagaatatggagctcgcggagtttcctactgtgccgtttgtgatggtgct
ttctttagaaaccaagaaattttagttattggtggtggtgactctgctgttgaagaagct
ctctacttgactcgttttggtcaatcagtaacaattatgcatcgtcgtgataaattgcgt
gcacaagaaattatccaacaaagagctttcaaagaagaaaaaatcaactttatttgggat
tctgttcctatggaaattaaaggggatgacaaaaaagttcaatccgttgtttataaaaac
gttaaaacgggtgaagtaactgaaaaagcttttggtggaatcttcatttatgtgggactt
gacccagttgctgaatttgctggtaatcttggaattactgatgaagccggttggattatt
accgatgaccatatgagaacaagtctacctggtatttttgccgtaggtgatgttcgtcaa
aaagatttccgtcaaatcactacagctattggtgatggagcgcaagcagctcaagaagct
tataaatttgtagctgaacttgattaa

DBGET integrated database retrieval system