KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1804
Entry
LLKF_1804         CDS       T01141                                 

Gene name
trxB
Definition
(GenBank) Thioredoxin reductase
  KO
K21567  ferredoxin/flavodoxin---NADP+ reductase [EC:1.18.1.2 1.19.1.1]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Brite
KEGG Orthology (KO) [BR:llk00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LLKF_1804 (trxB)
Enzymes [BR:llk01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.2  ferredoxin---NADP+ reductase
     LLKF_1804 (trxB)
  1.19  Acting on reduced flavodoxin as donor
   1.19.1  With NAD+ or NADP+ as acceptor
    1.19.1.1  flavodoxin---NADP+ reductase
     LLKF_1804 (trxB)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like DAO Thi4 NAD_binding_8 FAD_binding_2 FAD_oxidored K_oxygenase FAD_binding_3 Amino_oxidase Lycopene_cycl GIDA
Other DBs
NCBI-ProteinID: ADA65393
UniProt: D2BKT7
LinkDB
Position
complement(1863923..1864888)
AA seq 321 aa
MQELDLIIVGAGPVGLYAAFYAGMRGLSVAIIESAQVPGGQPQNLYPEKLIYDIAGLPAV
TGADLTKNLLEQLAQISHRLFLGESVQKIEKEGGFFSVTTDKSTRRAKGVLLTTGAGLLK
PRKLGIDNEETLANEGKISYFITSLKEFEGKNVAVFGGGDSALDWSLMLEKVAKNVHLVH
RRTAFRGHEITVDRVMNSNVQVHTPYTFSNLIENELELKKIKSEESLNFSIDKILVNYGF
LTNQVTLAENLEVSRNGRVKADSMMQSNIEGLYVAGDASDYPGKMPLMSVGFGEAVHAIN
AMTKKLEFDHPLRGGHSSSIF
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcaagaattagatttaattattgttggagcaggtcctgttggtctatatgcggctttt
tacgcaggaatgcgcggtttatcagttgcaataattgaatcagcgcaagttccaggtggt
caaccccaaaatctttaccctgaaaaattaatctacgatattgctggcctaccagcagtg
acaggggcagatttgacaaaaaatcttttagaacaactagcacaaatctctcatcgatta
tttcttggggagagcgttcaaaaaattgaaaaagaagggggttttttttctgtaactact
gataaatcaaccagaagagccaaaggcgttttgttgacgactggtgccggccttttgaaa
cctcgaaagttaggaattgataacgaagaaactttagccaatgaaggaaaaatatcttac
tttatcacttctctaaaagagtttgagggaaaaaatgttgcggtttttggtggaggagat
tcggctttagattggtcattaatgcttgaaaaagtagctaaaaatgttcatttggttcat
agaagaactgcttttcgtggtcatgaaattacagttgaccgagtgatgaattctaatgtt
caagttcatacgccttatactttttcaaatttgattgaaaatgaattagaattaaaaaaa
ataaaatcagaagaaagtttgaacttttcgattgataaaattttggttaattatggtttt
ttaacaaatcaagtgactttagctgaaaacttagaagtcagtcgtaatggtcgcgttaag
gccgattcaatgatgcaatccaatattgagggactttatgtcgcaggagacgcaagtgat
tatccgggaaaaatgcccttgatgtccgttggttttggtgaagcagtccatgcgattaat
gccatgacgaaaaaacttgaatttgaccacccacttagagggggacattcttcatccatt
ttttaa

DBGET integrated database retrieval system