KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_2376
Entry
LLKF_2376         CDS       T01141                                 

Gene name
noxD
Definition
(GenBank) NADH dehydrogenase
Organism
llk  Lactococcus lactis subsp. lactis KF147
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO Pyr_redox_dim HI0933_like K_oxygenase NAD_binding_8 3HCDH_N NAD_binding_9 FAD_oxidored Amino_oxidase GIDA AlaDh_PNT_C FAD_binding_3 NAD_Gly3P_dh_N
Other DBs
NCBI-ProteinID: ADA65925
UniProt: D2BMW9
LinkDB
Position
complement(2421454..2422785)
AA seq 443 aa
MKIVIVGSSHAGICAGLRALEEYPEAEITLYDKRNQVSFVSQGIISYLAGQKSVLNQSSY
SSVEELKAAGLNMQMETVVEEIDTKNKRLFYRRVNSKKTKLALYDKLIFATGSYPAMTSV
PFDKKSKLYFLKSMDDAIKTDEFLKTAKNIAVIGGGMTGVEVARIAQERGIQTTLIHRNK
NLLNDYLDEPASHLLESWMNAEGMRLLLNTEVTEIGFDEENTIIQTANGQKIPVDGVIFT
IGFRPNSYLLNQQVELGDSGAVIVDEYMQTTCPDVFAVGDVSTTYVNLLGKSYYLPHASD
AVRDGEIAAINLLAPRQKINSSQGTYHVPMNNLVIAMTGITIRQAVDAGYDADAVHLLNE
HLDGYSPSNIWMIYERRTHQILGLQCIGKTSDMAEYVNIFSLAIQQELKIEDIEFTDFYF
EHGYKDPRGLNRILARLVRENER
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgaaaattgttattgttggaagctcccacgccggaatttgtgccggattacgggcgctt
gaagaatacccagaagccgaaattacgctttatgataagcgtaatcaggtttcttttgtt
tctcaaggaattatttcttatctggcgggtcaaaaatctgtccttaatcaatctagttat
tcatcggtagaagaactaaaagctgctggtttaaacatgcaaatggaaacggtggttgaa
gagattgataccaaaaataaacggctattttatcggagagtcaattccaaaaagacgaaa
ctcgctctctatgataaattgatttttgctacgggttcttatccggcaatgacctctgtt
ccttttgataaaaaaagcaaactttactttttaaaaagtatggatgatgcaataaaaaca
gatgaatttctgaaaacagccaaaaatattgcagtaattggtggtggaatgaccggagtt
gaagttgctcggattgcccaagaaagaggaattcagacaacactcattcatcgcaataaa
aatcttttaaacgattatcttgatgaaccagcaagtcatttattggaaagttggatgaat
gcagagggaatgcgtcttctattaaatacagaagtgacagaaattgggtttgacgaagaa
aatacaatcattcaaacagcaaatggtcagaaaattcctgttgatggagtaatctttacg
attggttttcggcctaattcttatcttctgaatcaacaagttgagttaggagatagcgga
gcggttattgttgatgaatacatgcaaaccacttgtccagatgtttttgctgtcggagat
gtttcaacgacttatgttaatttgttgggaaaaagctattatctgccacatgcttcggat
gctgttcgcgatggtgaaattgcggcgattaatttacttgctcctcgccaaaaaattaat
agtagtcagggaacttatcatgttccaatgaataatttagtgatagctatgactgggatt
acaataagacaggcagttgatgctggttatgatgcagatgcggttcatttactaaatgaa
cacttagacggatattcaccaagtaatatttggatgatttatgagagacgcactcatcaa
attcttggtttacaatgtattggaaaaacgagcgatatggcagagtacgtcaatattttc
tcacttgcgattcaacaagaattaaaaattgaagatattgagttcacagacttttatttt
gaacatggctacaaagaccctcggggtctcaatcgcatattagctcgactagtaagggag
aatgaaaggtag

DBGET integrated database retrieval system