KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0171Help
Entry
llmg_0171         CDS       T00475                                 

Gene name
aspC
Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00220  Arginine biosynthesis
llm00250  Alanine, aspartate and glutamate metabolism
llm00290  Valine, leucine and isoleucine biosynthesis
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01130  Biosynthesis of antibiotics
llm01210  2-Oxocarboxylic acid metabolism
llm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:llm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    llmg_0171 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    llmg_0171 (aspC)
   00220 Arginine biosynthesis
    llmg_0171 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:llm01007]
    llmg_0171 (aspC)
Enzymes [BR:llm01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     llmg_0171 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     llmg_0171 (aspC)
Amino acid related enzymes [BR:llm01007]
 Aminotransferase (transaminase)
  Class I
   llmg_0171 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: CAL96778
UniProt: A2RHP1
LinkDB All DBs
Position
162090..163304
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVISDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRMGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtttgaaaaatcgcataaacttgataatgtcagctatgatattcgtggtcca
gtgcttgatgaagcacagcgtatgcgagccaatggtgaaaaaattcttcggttgaataca
ggaaatccagcagaatttggttttcttgccccagacgaagtgattagcgatttgattcag
catgctgtggatagcgaaggctattcagattctaaaggtattttctcggctcgtaaggcg
attatgcaatactgtcaacttaaaggtttccctaatctggatatcaatgacattttcact
ggtaacggtgtttctgaattaatcgttatggctatgcaaggccttttggatacgggtgat
gaggttttgatccctatgcctgattatccgctctggacggcttctgtcagcttagctggg
ggaacagcggttcactatctctgcgatgaacaagctggctggtttccggatattgatgat
attcgctcaaaaattactagtaatactaaagccattgttttaattaatcctaataatcca
acgggcgcgttgtattctaaagatttattacttgaaattgtccaagtggctagagaaaat
aatttaattatcttttcggatgagatttatgaccgtttggtcatggacggcgctgttcat
gttccgattgccagcttagcacctgacctttttgtggtcacaatgaatggactttccaag
tcacatcgtattgctggatttcgtatgggctggatggttctgtcaggtgagaaatcgcat
gtcaaaggctatatcgaaggcttgaacatgctcgcttcaatgcgactttgttcaaatgtt
ttggctcagtctgttgtgcaaacctcacttggtgggactcaatctgttgataagctgctt
ttgccagggggacgagtttatgaacaaagagaattcatttataaagccattaatgatatt
ccaggattatctgccgtgaagccacaagctgctttctatattttccctaaaattgacaga
gaaatgtataaaattgataatgatgaacaatttgttttagactttttaaaacaggaaaag
atacttcttgttcatggtcgaggattcaattggaaggatcctgatcattttcggattgtc
tatctgcctcgtgtagatgaactggcggaaatacaggaaaaaatggaacgctttttatgg
cagtatcgtaaataa

DBGET integrated database retrieval system