KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0357Help
Entry
llmg_0357         CDS       T00475                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Brite
KEGG Orthology (KO) [BR:llm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    llmg_0357 (ahpF)
Enzymes [BR:llm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     llmg_0357 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 FAD_binding_2 HI0933_like DAO Thi4 FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Glutaredoxin K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: CAL96962
UniProt: A2RI69
LinkDB All DBs
Position
342883..344409
Genome map
AA seq 508 aa AA seqDB search
MILDENLRSQLLPYMDLLENPIILKVDADDSENGQKINEFTDELASLSDLISKEKTNLNH
KPAFSIEREGVSGLVFSGLPLGHELNSLVLALVQVSGRPPRIEQELIEQIKAIKTSLHFD
TYVSLTCHNCPDVVQALNTMTILNPNISHTMIEGGMFQAEVEAKGIMAVPAVFKNGEEFH
SGRASLEELLEKITGPESSDSFAEKEPYDVLVVGGGPAGASAAIYAARKGIRTGLIAERF
GGQPLETLGIENLIGTPYIEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDLIEVSLAN
GATLKSKAVILSTGARWRDLGIPGEQRFKNKGVAYCPHCDGPLFSGKDVAVIGGGNSGIE
AAIDLAGLVNHVTVLEFLPELKADKILQKKLASLTNVTVLTNVETKEILGDEQVTGLNYQ
VRGSKETIHLELAGVFVLIGLVPNTQWLEGTIDLTDRHEIVTDKVGATNIPGVFAAGDCT
DTVYKQIIVSMGSGATASLGAFDYLIRN
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaaaatctgcgttctcagttactgccgtatatggatttattagaaaat
ccaattattttaaaagtggacgcagacgatagtgaaaatggacaaaaaataaatgaattt
acagatgaactggcaagtttatcagacttgatttcaaaagagaaaacaaatctgaatcat
aaaccggctttttcaattgaaagagaaggtgtttcagggcttgttttttcaggtcttcct
ttaggtcatgagttaaattcattggttttggcccttgtgcaagtgagtggtcgaccacca
cgtattgaacaagaattaattgaacaaattaaggctattaaaacttcacttcattttgat
acttatgtcagtttaacttgtcataattgtccagatgtggttcaagctttaaatacaatg
accattctcaaccctaacattagtcataccatgattgagggaggcatgttccaagcagaa
gtagaagcaaaaggaattatggctgttcctgctgtctttaaaaatggcgaagaatttcat
agtggacgagcaagtcttgaagaattgttggaaaaaattacaggtccagaaagttcggat
agtttcgcagaaaaagaaccttatgatgttttggtagtaggaggggggccagctggtgcg
agtgcagctatttatgcggcacgtaagggaatcaggacaggattgattgccgagcgcttt
ggaggccaacctttagaaactttagggattgaaaatctgattggaacaccctatatagag
ggtgttcagcttggtcgtcagcttgaagaacacgtaaaaaaatatccagtagatttgatg
aatctgcaaaaagcagttaaacttgagaaaaaagatttaattgaagtaagtcttgcaaat
ggagcaaccttgaagagtaaagctgttattctctcaactggcgctcgttggcgtgattta
ggaatcccaggagaacaacgctttaagaataaaggagtggcttattgtcctcattgtgat
ggtccgcttttctctggtaaagatgtggcagttattggtggaggaaattcagggattgaa
gcagcgatagacttagctggtttggtcaaccatgtcactgttcttgaatttttaccagaa
cttaaagcagataaaatcttacaaaaaaaacttgctagtctaactaatgttactgttttg
accaatgtggaaactaaagagattctaggagatgagcaagtcacggggttgaattatcaa
gttcgaggctctaaagaaacgattcatttagaacttgccggtgtctttgttttgattggt
ttagttcccaatactcagtggttggaagggacaattgatttgacagatcgtcatgaaatt
gtgactgataaggttggagcaacaaatattcctggtgtctttgcagcaggagattgtaca
gatactgtttataaacaaattattgtgtcaatgggaagtggagcgactgcttccttaggt
gcctttgattatttgataagaaattaa

DBGET integrated database retrieval system