KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0586Help
Entry
llmg_0586         CDS       T00475                                 

Gene name
gnd
Definition
(GenBank) 6-phosphogluconate dehydrogenase, decarboxylating
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00030  Pentose phosphate pathway
llm00480  Glutathione metabolism
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01120  Microbial metabolism in diverse environments
llm01130  Biosynthesis of antibiotics
llm01200  Carbon metabolism
Module
llm_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:llm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    llmg_0586 (gnd)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    llmg_0586 (gnd)
Enzymes [BR:llm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     llmg_0586 (gnd)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     llmg_0586 (gnd)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 6PGD NAD_binding_2 Shikimate_DH 3HCDH_N 2-Hacid_dh_C HMG_box_5 Ub-Mut7C
Motif
Other DBs
NCBI-ProteinID: CAL97186
UniProt: P96789
LinkDB All DBs
Structure
PDB: 

Position
573365..574783
Genome map
AA seq 472 aa AA seqDB search
MAQANFGVVGMAVMGKNLALNVESRGYTVAIYNRTTSKTEEVYKEHQDKNLVFTKTLEEF
VGSLEKPRRIMLMVQAGAATDATIKSLLPLLDIGDILIDGGNTHFPDTMRRNAELADSGI
NFIGTGVSGGEKGALLGPSMMPGGQKEAYDLVAPIFEQIAAKAPQDGKPCVAYMGANGAG
HYVKMVHNGIEYGDMQLIAESYDLLKRILGLSNAEIQAIFEEWNEGELDSYLIEITKEVL
KRKDDEGEGYIVDKILDKAGNKGTGKWTSESALDLGVPLPLITESVFARYISTYKDERVK
ASKVLSGPALDFSGDKKEVIEKIRKALYFSKIMSYAQGFAQLRKASEEFDWDLPYGTIAQ
IWRAGCIIRAEFLQNITDAFDKDSELENLLLDDYFVDITKRYQEAVRDVVSLAVQAGTPI
PTFTSAISYYDSYRSENLPANLIQAQRDYFGAHTYERTDKAGIFHYDWYTED
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagcaaactttggtgttgtcggaatggctgtaatgggtaaaaaccttgcactc
aatgttgagtcacgtggttataccgttgctatctacaaccgtacgacttcaaaaactgaa
gaagtttataaagaacatcaagataaaaatcttgttttcacaaaaacacttgaagaattt
gtcggaagtcttgaaaaaccacgtcgtatcatgctcatggttcaagcgggagctgctact
gatgcaaccatcaaatcactcttaccacttttggacataggcgacatcttgattgatggt
gggaatactcatttcccagatacaatgcgtcgtaatgctgaacttgctgactcaggaatc
aacttcattggtactggtgtttcaggtggagaaaaaggagcgctcttgggcccttctatg
atgcctggtggacaaaaagaagcttatgatttagtagctccaatttttgaacaaatcgca
gctaaagctcctcaagacggtaaaccatgtgttgcttatatgggagccaatggtgcggga
cattacgttaaaatggttcataacggaattgagtatggcgacatgcaattgattgctgaa
tcttatgaccttttgaaacgtattcttggacttagcaacgcagaaattcaagccattttt
gaagaatggaatgaaggcgaacttgatagctacctcatcgaaatcacaaaagaagtattg
aaacgtaaagatgatgaaggcgaaggctatatcgttgataaaattcttgataaagcagga
aataaaggaactggtaaatggacttcagaatctgcccttgaccttggtgtaccacttcca
ttgattacagaatcagtatttgctcgttacatttcaacctataaagatgaacgtgttaaa
gcaagcaaagttttgtctggcccagctcttgatttctcaggcgataaaaaagaagtaatc
gaaaaaatccgcaaagcactttatttctcaaaaattatgagttatgctcaaggatttgct
caacttcgcaaagcttctgaagaatttgattgggacttgccatacggtacaattgctcaa
atttggcgtgctggatgtatcatccgtgcagaattcctccaaaacattactgatgctttc
gataaagatagcgaacttgaaaacctcttgcttgatgactactttgtagacatcacaaaa
cgttatcaagaagctgttcgtgatgtggtttcacttgctgttcaagcaggaactccaatt
ccaacattcacctcagcaattagctactacgatagctatcgctctgaaaatcttcctgca
aacttgattcaagctcaacgtgactatttcggtgctcacacttatgaacggactgataaa
gcaggaattttccattacgactggtatacagaagattaa

DBGET integrated database retrieval system