KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_00480Help
Entry
LLNZ_00480        CDS       T02131                                 

Definition
(GenBank) putative glyoxylase protein
  KO
K15975  glyoxalase family protein
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Brite
KEGG Orthology (KO) [BR:lln00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99999 Others
    LLNZ_00480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase
Motif
Other DBs
NCBI-ProteinID: ADJ59116
LinkDB All DBs
Position
90917..92086
Genome map
AA seq 389 aa AA seqDB search
MTESTKIVAQIPGALTLGGVHHVTAITSSAQKIYDFFTNILGLRLAKLTVNQDDYETYHL
FFTEEDGHGADMTFFDFKDIPKGNHGVNNIERASFRVPTDASLDYWSTRFDNAHVKHGEI
SSKFGQNTLEFEDFDGQLYQLISDQNNNGDASKGHSWQLSNVPQEHGITGLGPVFVKVEN
AKNLRSILETVFGFRYAGQEGDLHLFEVANGGNGAALILQEAGEKESYAYQGYGTIHHLA
LGTTNPETLNYWIERIKAFRLPHSGLVDRFYFSSEYVRVAPGVLFEIATYTPGIGALDMA
KSGSGAVDSYEEALITSGFWIDQSKEESGLSLSLPPHLFPGDEATKARTAASLRPLDTSD
AHRDRTRDELWTVEKVLEHKAGTPVETLK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatcaacaaaaatagtagcacaaatccctggagctctcactcttggtggagtt
caccacgttacagcaattacttcaagtgctcaaaaaatttatgatttttttacaaatatc
ttgggacttcggctagcaaaattaaccgtgaatcaagacgattatgaaacctatcacctc
tttttcacagaagaagacggacatggagccgatatgacattctttgatttcaaggatatt
cctaaaggaaaccatggggttaataatatcgaacgcgcttcattccgagtacccacagat
gcttcattggattattggagcactcgctttgataatgcccatgttaaacatggcgaaatt
tcaagtaagtttggtcaaaataccttagagtttgaagattttgatggtcaactttatcaa
ttaatttctgaccaaaataataacggggatgcttctaaagggcattcttggcaactttca
aatgttccgcaagaacatgggattactggactgggcccagtttttgtgaaagtggaaaac
gccaaaaatcttcgttcaattttggaaacagtttttggattccgttacgctggtcaagaa
ggggatttacacctttttgaagtagccaatggtgggaatggggcggctttgattcttcaa
gaagctggtgaaaaagaatcctatgcctatcaaggttatggtacaattcaccatttagca
ttgggaacaacaaaccctgaaacattgaattattggattgaacgcattaaagccttccgt
ttgcctcattcaggtttggttgaccgattctatttctcaagtgaatatgttagagttgcg
ccaggtgtactctttgagattgcgacatatacaccgggaattggagcacttgatatggca
aaatctggttcaggggctgttgattcttatgaagaagcattgattacttctggtttctgg
attgaccaaagtaaagaagaatcgggtttgtctttgagtttgcctcctcatttattccca
ggagatgaagcaaccaaggcaagaactgcagctagtttacgtcctttggatacctcagat
gctcaccgtgatcgtacgagagatgaattgtggacggttgaaaaagtattggaacataaa
gcgggaactccagttgaaacgctgaaataa

DBGET integrated database retrieval system