KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_00740Help
Entry
LLNZ_00740        CDS       T02131                                 

Definition
(GenBank) major facilitator superfamily permease
  KO
K08161  MFS transporter, DHA1 family, multidrug resistance protein
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Brite
KEGG Orthology (KO) [BR:lln00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lln02000]
    LLNZ_00740
Transporters [BR:lln02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    LLNZ_00740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_3 BT1 MFS_4
Motif
Other DBs
NCBI-ProteinID: ADJ59166
LinkDB All DBs
Position
complement(136666..137862)
Genome map
AA seq 398 aa AA seqDB search
MKESWQRNLIVLWFGTFMTGIGSSLISPFISLYIGTLGHYSKTELNIWSGLVFSSTFIVL
AIVSPLWGRLADQKGRKLMLLRASLGMAISISLMAFVTAAWQLLILRMLLGAFSGFVSNS
MALMASSAPKEKSGSVLSLLTTGSVAGTLIGPIVGGVLVNITGYRRVFSVTGIIMFLVFF
LALFLVKETFKPVEKKNMLSYKQVWEVVTHPAIIWGMFFATLITQMTNQSINPVLSLYVQ
ELMHGQGNITFMAGLVAAAPGIVTLVAAPFLGRLGDKVGQRKILGFGLFFSLIVFSITAL
TTNVWFLIVMRLFVGISDAAILPSVQAILAKESPQAVTGRIFSYNQSAQSIGAFAGPLLG
SAIAGFIDYRYVFVGSAILVIFNLINYFTHNNSVTLKK
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaatcatggcaacgaaatttaatcgtcctttggtttgggacatttatgacggga
attggctcaagccttatttccccttttatatcactctatatcggaacactaggtcactat
tcaaaaacagaattaaatatttggtctggtctggttttctcatctacttttattgtttta
gccatcgtttctcccctatggggaagattagctgaccaaaaaggtcgaaagttgatgctc
ttaagagcctctctcggaatggccatttcaatttctctaatggctttcgtcacggctgct
tggcaactccttattttgagaatgttgcttggtgctttttctggatttgtatccaattca
atggctttgatggcaagctcggcacccaaagaaaaatccggttcagttttatcattactc
acaacaggttctgtagctggaacattaatcggacctatagttggtggggtcctcgttaat
ataactggatatcgtcgtgtctttagcgtcacaggtatcatcatgttccttgtttttttc
cttgcactttttttggtcaaagaaacttttaaaccagttgaaaagaaaaacatgctctcc
tacaaacaagtatgggaagttgtcacacaccctgcaataatatggggaatgtttttcgca
acattgattacccaaatgaccaatcaatccattaatcctgttctttcactctatgtacaa
gaactcatgcatggtcaagggaatatcactttcatggctgggcttgtcgccgccgctcca
ggaatagtaaccttagttgctgccccatttttagggagacttggtgataaagtcggtcaa
agaaaaattcttggctttggacttttcttctcacttattgtcttttcaattaccgcactg
acaactaatgtttggtttctgattgttatgaggctctttgtcggaatttctgatgctgcg
attttaccatctgttcaagctattctggccaaagaatctcctcaagctgtcaccggccgt
attttctcttacaatcaatccgctcaatcaatcggtgcctttgctggtcctctattaggc
tcagctattgctggttttatcgactatcgttatgtatttgtaggttcagcaatccttgtc
atcttcaatctgatcaactactttacacacaataattcagttacactaaaaaagtaa

DBGET integrated database retrieval system