KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_00905Help
Entry
LLNZ_00905        CDS       T02131                                 

Definition
(GenBank) aminotransferase AlaT
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Pathway
lln00220  Arginine biosynthesis
lln00250  Alanine, aspartate and glutamate metabolism
lln00290  Valine, leucine and isoleucine biosynthesis
lln01100  Metabolic pathways
lln01110  Biosynthesis of secondary metabolites
lln01130  Biosynthesis of antibiotics
lln01210  2-Oxocarboxylic acid metabolism
lln01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lln00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LLNZ_00905
   00290 Valine, leucine and isoleucine biosynthesis
    LLNZ_00905
   00220 Arginine biosynthesis
    LLNZ_00905
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lln01007]
    LLNZ_00905
Enzymes [BR:lln01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     LLNZ_00905
    2.6.1.66  valine---pyruvate transaminase
     LLNZ_00905
Amino acid related enzymes [BR:lln01007]
 Aminotransferase (transaminase)
  Class I
   LLNZ_00905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ADJ59197
LinkDB All DBs
Position
162090..163304
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVISDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRMGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtttgaaaaatcgcataaacttgataatgtcagctatgatattcgtggtcca
gtgcttgatgaagcacagcgtatgcgagccaatggtgaaaaaattcttcggttgaataca
ggaaatccagcagaatttggttttcttgccccagacgaagtgattagcgatttgattcag
catgctgtggatagcgaaggctattcagattctaaaggtattttctcggctcgtaaggcg
attatgcaatactgtcaacttaaaggtttccctaatctggatatcaatgacattttcact
ggtaacggtgtttctgaattaatcgttatggctatgcaaggccttttggatacgggtgat
gaggttttgatccctatgcctgattatccgctctggacggcttctgtcagcttagctggg
ggaacagcggttcactatctctgcgatgaacaagctggctggtttccggatattgatgat
attcgctcaaaaattactagtaatactaaagccattgttttaattaatcctaataatcca
acgggcgcgttgtattctaaagatttattacttgaaattgtccaagtggctagagaaaat
aatttaattatcttttcggatgagatttatgaccgtttggtcatggacggcgctgttcat
gttccgattgccagcttagcacctgacctttttgtggtcacaatgaatggactttccaag
tcacatcgtattgctggatttcgtatgggctggatggttctgtcaggtgagaaatcgcat
gtcaaaggctatatcgaaggcttgaacatgctcgcttcaatgcgactttgttcaaatgtt
ttggctcagtctgttgtgcaaacctcacttggtgggactcaatctgttgataagctgctt
ttgccagggggacgagtttatgaacaaagagaattcatttataaagccattaatgatatt
ccaggattatctgccgtgaagccacaagctgctttctatattttccctaaaattgacaga
gaaatgtataaaattgataatgatgaacaatttgttttagactttttaaaacaggaaaag
atacttcttgttcatggtcgaggattcaattggaaggatcctgatcattttcggattgtc
tatctgcctcgtgtagatgaactggcggaaatacaggaaaaaatggaacgctttttatgg
cagtatcgtaaataa

DBGET integrated database retrieval system