KEGG   Lactococcus lactis subsp. cremoris NZ9000: LLNZ_07480Help
Entry
LLNZ_07480        CDS       T02131                                 

Definition
(GenBank) DNA gyrase subunit A
  KO
K02469  DNA gyrase subunit A [EC:5.6.2.2]
Organism
lln  Lactococcus lactis subsp. cremoris NZ9000
Brite
KEGG Orthology (KO) [BR:lln00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lln03032]
    LLNZ_07480
   03400 DNA repair and recombination proteins [BR:lln03400]
    LLNZ_07480
Enzymes [BR:lln01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     LLNZ_07480
DNA replication proteins [BR:lln03032]
 Prokaryotic type
  DNA Topoisomerases
   LLNZ_07480
DNA repair and recombination proteins [BR:lln03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHIIR (short-homology-independent illegitimate recombination)
     Facilitator
      LLNZ_07480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_topoisoIV DNA_gyraseA_C Rho_RNA_bind
Motif
Other DBs
NCBI-ProteinID: ADJ60440
LinkDB All DBs
Position
complement(1420102..1422591)
Genome map
AA seq 829 aa AA seqDB search
MQDKNVINVNLVEEMKTSFRDYAMSVIVARALPDVRDGLKPVHRRILYGMNELGNTPDKP
HKKSARIVGEVMGKYHPHGDSSIYEAMVRMAQWWSYRHMLADGHGNFGSMDGDGAAAMRY
TEARLSKIAMEMLRDINKNTVDFMDNFDGTEREPLVLPARFPNLLVNGTTGIAVGMATNI
PPHNLGETIDAVDMLMENPEASVTDLMSVIPGPDFPTGALVMGKSGIRRAYETGKGSITL
RAKTHIEEMAGGKERIVVTELPYMVNKARLVEHIVRLNHEKRIEGLTAVRDESNREGIRV
VIEVRRDLSAHVILNNLFKLTSLQTSFGFNMLAIEKGIPKILSLKEILVDYIEHQIEVVE
RRTAFDKARAEARAHILEGLRIALDNIDRIITIIRESQTDAIAQKTMMDEFLLSEKQSQA
ILDMRLRRLTGLERDKIEAEYQDLVALIADLTDILAKPERVKKIIREELEEVKRKFADKR
RTELLVGEVLTLEDEDLIEEEDVLITLSNKGYIKRLANDEFRAQNRGGRGVQGMGMSDDD
FVQHLVSTSTHDHLLFFTNLGRVYRMKGYEIPEYGRTAKGLPIVNLLKLDDGEKIATIIN
VDRDQAAKYLFFTTRNGIVKRTSTSQFSNIRTNGLKALKLRDGDELINVLRTSGEDEVII
GTHLGYSVRFKGAIVRDMGRAAAGVKGVNLREGDFVVGTSRIDDNQEVLVISENGLGKRT
QASEYPTKGRGGKGMKVMNVTERTGKLAGLTAVNGDEDLMVITDTGVIIRTNVANISQTG
RAAQGVKVMRLDDEAQIVTFALVDPVIEEEETDSPEVTDEALSTDTNEE
NT seq 2490 nt NT seq  +upstreamnt  +downstreamnt
atgcaagacaaaaatgttatcaatgtcaatttagttgaggagatgaagacgtcatttcgt
gactatgcaatgtcagttatcgttgcacgggcacttcctgatgtacgtgatggattaaaa
cccgttcaccgtcgtattctctacggaatgaatgaactggggaatactccagataaacct
cataaaaaatcggctcgtattgtcggtgaagttatgggtaaatatcacccacatggagac
agttcaatctatgaagcaatggtacgtatggctcaatggtggtcttatcgtcatatgctt
gctgacggacacggtaactttggttcaatggacggcgacggtgccgcagcaatgcgttat
accgaagctcgtttaagtaaaattgccatggaaatgttgcgagatatcaacaaaaatacc
gttgatttcatggacaatttcgatggaactgaacgtgaaccacttgttttacctgctcgt
ttcccaaaccttttagttaatggaaccacagggattgccgttgggatggcaacaaacatt
ccaccgcataaccttggtgaaacgattgatgcagtagatatgcttatggaaaacccagaa
gcttccgttactgatttgatgtctgtcattcctggtcctgacttcccaacaggggctttg
gttatgggtaaatctgggattcgtcgtgcttatgaaactggtaaaggttcaattacatta
cgtgcaaaaacccacattgaagaaatggctggtggaaaagaacgcattgttgtgactgaa
ttaccatatatggttaacaaggcgcgcttggttgaacatattgttcgtttgaaccatgaa
aaacgtattgagggcttgactgcggttcgtgatgaatcaaaccgtgaaggaattcgtgtg
gttattgaagtgcgtcgtgacttatcagcacacgttatcctaaataatcttttcaaactg
acaagtttgcaaacttcatttggtttcaacatgttggctatcgaaaaaggaattcctaaa
attctttctttgaaagaaattttagttgattatattgaacatcaaatagaagttgtcgaa
cgtcgtacagcctttgataaagcacgtgcagaagcacgggcacatatcttagaaggttta
cgtatcgctcttgataatattgaccgtatcatcacaattatccgtgaatcacaaactgat
gctattgctcaaaaaacaatgatggatgaattcctcttgtctgagaaacaatcacaagcc
attcttgatatgcgtttgcgtcgtttgacaggtttggaacgtgacaaaattgaagctgaa
tatcaagatttagttgctttgattgctgacttgacggatattttagcaaaacctgaacga
gttaagaaaattattcgtgaagaattagaagaagttaaacgtaaatttgctgacaaacgt
cgaacagaattgttagttggtgaggttcttactcttgaagatgaagatttgattgaggaa
gaagatgtattgattactttatcaaataaaggatatatcaaacgtttggctaacgatgaa
ttccgtgctcaaaatcgcgggggacgtggtgttcaaggaatgggtatgtccgatgatgac
ttcgttcaacatttggtatctacatcaacacatgatcatttactcttctttacaaatctt
ggacgtgtctaccgaatgaaaggatatgaaattcctgaatatggtcggacagctaagggc
ttaccaattgtcaatctcttaaaacttgatgatggtgaaaaaattgcaacaatcatcaat
gttgaccgtgaccaagcggcgaaatatctcttcttcacaacacgcaacggaattgttaaa
cgaacttcaacgagtcaatttagcaatattcggacaaatggtttgaaggctttgaaactt
cgtgatggcgatgagttgattaatgtgcttagaacttcgggtgaagatgaggttattatc
gggactcacttaggttactctgttcgtttcaaaggtgccattgttcgcgatatgggccgt
gctgcagctggagtcaagggggttaacctccgagaaggtgactttgttgttggaacttca
agaattgatgacaatcaagaagtccttgttatctcagaaaatggtcttggtaaacgaact
caagcttcggaatatccaacaaaaggccgtggtggtaaagggatgaaagtcatgaatgtc
acagaaagaactggtaaattagctggtttaactgcagtcaatggtgacgaagacttgatg
gtcattacagatacaggggttattatccgtacaaatgtggctaatatttctcaaactggt
cgtgcagcccaaggggttaaagtaatgcgacttgatgatgaagcacaaattgtaactttt
gcacttgtagatccagtaatcgaagaggaagaaactgactcgccagaagttactgacgaa
gctctttctactgacacaaatgaagaataa

DBGET integrated database retrieval system