KEGG   Legionella longbeachae: LLO_0857Help
Entry
LLO_0857          CDS       T01183                                 

Gene name
ftsI
Definition
(GenBank) transpeptidase involved in septal peptidoglycan synthesis (penicillin-binding protein 3)
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
llo  Legionella longbeachae
Pathway
llo00550  Peptidoglycan biosynthesis
llo01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:llo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LLO_0857 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LLO_0857 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:llo01011]
    LLO_0857 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:llo03036]
    LLO_0857 (ftsI)
Enzymes [BR:llo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LLO_0857 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:llo01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   LLO_0857 (ftsI)
Chromosome and associated proteins [BR:llo03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    LLO_0857 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: CBJ11202
Pasteur: llo0857
UniProt: D3HQN2
LinkDB All DBs
Position
981830..983497
Genome map
AA seq 555 aa AA seqDB search
MKKSTHLNRLIIVSAFFSLLLVILVLRMVDLTVLHRQFLQGQGNARSLRVVDIPAHRGMI
MDRNGTPLAISTPVESVWVNPKEFAPDKEQFMSLAAYLNFTPQQLSRKIVDAENKELEFV
YLQRQLPPPLAKQIKALKIPGVNFQKEFKRYYPDSDSISQLVGFTNVDDQGLEGIELAYQ
DWLKGVVGKKRVIKDRLGRIIDELGVIKEPRPGRDMTLSIDRRLQYLAYSELGKTVEEFA
AKSGSVVVVDTENGEILAMANVPSYNPNSRGRYDKDTYRNRAVTDTFEPGSVIKTFSIAS
ALETGLFKPSTIIDTNPSWMVVHGHAVRDIHNYGVLDVTGVLQHSSNVGVTKMVLASPPE
QLIGLLQRCGFGQRTESTYPGESEGGIVNAKDANPFVLATLSFGYGLSVTALQLAKANMI
FANQGKLIPVTLLHNDPPTPGVQVIKPETAQQVLNMMEAVMKDGTGRAAKVPGYRVAGKT
GTARVAGKDGYKDKKYTASFVGIAPVSKPKFVVVVIIHEPSRKGYYAAAVAAPLFTKVMS
GALRLFNIPTDELVG
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatcaacccatcttaatcgacttatcattgtatctgctttcttttcgttgctt
ttagttattttggttttgcgaatggttgatttaaccgttcttcatcgacaatttcttcaa
ggccagggtaatgcgcgaagtttacgggtagtagatattccggctcatagagggatgatc
atggataggaatggtactcctttggcaattagtacccctgtagagtcagtctgggttaat
cccaaggagtttgcgccagacaaagagcaatttatgtcattggcagcgtatttaaatttt
actccccagcaattaagccgcaaaatagtagacgctgaaaataaagaattagagtttgtt
tacttacaaagacaattaccacctcctttagcgaagcaaataaaggcacttaagattccg
ggtgttaattttcaaaaagaatttaaacgttattatcctgattccgacagcatttcgcag
ttggtgggttttacaaacgtcgatgatcaggggttagagggcatagagctagcttatcaa
gactggttaaaaggtgttgtgggtaaaaagagagtaattaaagatcgtttgggtcgaatt
attgacgaattaggagtaattaaagagccacgccctggacgtgatatgactttaagtatt
gataggcgattgcagtatttagcgtacagtgagttgggcaaaactgtagaagagtttgct
gcaaaatccggttctgtagttgtcgtcgacactgaaaacggtgaaattttagccatggct
aatgtcccttcctataatccaaattcacgtggtcgttatgacaaagatacttacagaaat
agggcggttacagatacatttgagccaggttccgtaatcaaaacgttcagtatagcaagt
gccttagaaacgggattgtttaaaccttcaactattatagatacaaatcctagctggatg
gttgttcatggccatgcggtacgtgacatccataattatggtgttttggatgtgacgggg
gtattacaacactcgagtaatgtcggggtaacaaaaatggttttggcaagccctccagaa
caactaatcggtctattgcaacgttgtggttttggccaacgcacagaaagtacctatcct
ggcgaaagtgaaggtggaattgttaacgccaaagatgctaatcctttcgttttggccact
ttaagttttggttatggactgtctgttaccgcattacaattggcaaaggccaatatgatt
tttgcaaatcaaggaaaactgattccagtgactttgctgcataatgatcctcccactcct
ggagtacaagtcataaaaccggaaacagcacaacaggttctaaatatgatggaagcggtt
atgaaggatgggacgggtcgagctgcaaaagtacctgggtatcgtgtagccgggaaaacc
ggaacagcgcgcgtagcaggaaaagatggatataaggataaaaaatataccgctagtttt
gtaggtattgcacctgtttcaaaacctaaatttgttgtggttgttataatccatgaaccc
tcccgaaaaggatattatgctgccgctgttgctgctcctttgtttacaaaagtcatgtca
ggggcattgaggctgtttaatatacctacggatgagttagtggggtaa

DBGET integrated database retrieval system