KEGG   Legionella longbeachae: LLO_0880Help
Entry
LLO_0880          CDS       T01183                                 

Gene name
aroB
Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
llo  Legionella longbeachae
Pathway
llo00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01130  Biosynthesis of antibiotics
llo01230  Biosynthesis of amino acids
Module
llo_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:llo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LLO_0880 (aroB)
Enzymes [BR:llo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     LLO_0880 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: CBJ11225
Pasteur: llo0880
UniProt: D3HQQ5
LinkDB All DBs
Position
1010909..1012012
Genome map
AA seq 367 aa AA seqDB search
MANFEVYEQVDVCLAEHQYPVIICRNGLQNLNFLQTLVISSQVLIVTNQTIAALYLKQIQ
AAFAAIQCDVVILEDGEQHKNQQSLFAIYDALIQNKHHRDTTLIALGGGVVGDMAGFAAS
TYQRGVKFIQIPTTLLAQIDASIGGKTGINHPLGKNMIGSFYQPQAVVIDLATLNSLPER
EFRAGIAEMIKYGLLAGGAFYKQLFAALQMGLTANNPQLPQLIATCCKIKAEFVQNDEKE
SGQRALLNLGHTFAHALEAYTHYQQWLHGEAVAIGIYCAAILSYKMKLINEQLVAQIEQI
LTSAGLPHKIPSTINLKKLIDLMRLDKKVKNNRLRFILIKNPGSCYLEARITEDSLYHAL
VAAVKGE
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgaactttgaggtttatgagcaggttgatgtttgtttagctgaacatcaatatcct
gtaattatttgtcgaaatggcttgcaaaatttaaattttttgcaaacattggtcatttct
tcacaggttttgattgttacaaatcaaaccattgctgccctttatttaaaacagatacaa
gctgcttttgctgcaattcaatgtgatgtggtgattttggaagatggtgagcaacataag
aatcaacaaagcttatttgcaatctatgatgcattaatacaaaacaaacatcacagggat
actacgcttatagctttaggtgggggtgtggtgggtgatatggctggatttgcagcctca
acataccaaagaggggtgaaatttatacaaattccaaccactttattagcgcaaatcgac
gcttcaattggtggtaaaactggaattaatcatcctttaggaaaaaacatgattggtagt
ttttatcaaccccaagcagtggttattgatttggctaccttaaactcgcttccagaaaga
gagtttcgtgcagggattgctgagatgatcaagtatggactacttgctggaggagcgttt
tacaagcagttgtttgctgcattgcaaatgggattgactgccaataaccctcaattacct
caattaattgcaacatgttgcaaaatcaaagctgaatttgttcaaaatgatgagaaagaa
tcaggtcaacgcgcgctgctcaatcttggccatacttttgctcatgcgttagaggcatat
acccattatcaacaatggctgcatggcgaagcagttgcaataggcatctattgtgcagcg
attttgtcctataaaatgaaattaatcaatgaacagttggttgcgcaaattgaacaaata
ttaacaagcgccggtttgccacataaaattccaagcactataaacttgaaaaaacttata
gatttgatgcgattagataaaaaggttaaaaataatcgattacgctttatcttaattaaa
aatcctggtagttgttatctcgaggccagaatcacagaagatagtttatatcatgcacta
gttgcggctgtaaaaggagaataa

DBGET integrated database retrieval system