KEGG   Legionella longbeachae: LLO_1004Help
Entry
LLO_1004          CDS       T01183                                 

Definition
(GenBank) hypothetical protein
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 Genetic Information Processing
  Replication and repair
   03450 Non-homologous end-joining
    LLO_1004
Enzymes [BR:llo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LLO_1004
DNA repair and recombination proteins [BR:llo03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     LLO_1004
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: CBJ11356
Pasteur: llo1004
UniProt: D3HR29
LinkDB All DBs
Position
complement(1185531..1186412)
Genome map
AA seq 293 aa AA seqDB search
MKIAGIDISHADKLLYPDDKISKGEVAEYFYKISDYLLPFVQKRLITLKRYPEGINENGF
YNKHRPDYFPDFIKEYTVPTLKDNSEMNMVGISSKKALVYLAGQDVLELHISLSTISSIE
KPDQIIFDFDPQDDDFEKVREAAFTLKKIFEEYDLTAFVKTSGSRGLHIHLPLKTHYKFD
KIKSISRKIAERLHQKCPKITTLEHRKDKRGNKVFIDFLRNDYAMTAITPYSLRARKGAP
IATPLEWEELNDNSLTPRSYHLKNIFQRLEKKPNPWKNFNRYNRNIDINDLFK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgctggtattgatatctcgcatgcagataaattactttatccagatgacaaa
atttcaaaaggggaagttgcagaatatttttataaaatctcggattaccttttgcctttt
gtacaaaaaagactaattactctgaaacgatatcctgaggggatcaacgaaaatggtttt
tataacaagcatcgtcccgattattttcctgatttcattaaagaatatactgtacccacc
ctgaaagataattctgaaatgaacatggtgggaattagttccaaaaaagcattagtctat
ctggcaggtcaagatgttcttgaattacatatttcattatcaacaatatcttcaattgaa
aagcctgatcaaattatctttgactttgatccccaagatgatgattttgaaaaagtgcgt
gaggcagcatttactttaaaaaaaatatttgaagaatatgatctcactgcttttgtcaaa
acatctggttctcgtgggcttcatattcatttgccactaaaaacgcactacaaattcgat
aagattaaatctatatcacgaaaaattgcagaaagactacatcagaaatgtcctaaaata
accaccctagaacatagaaaagacaaacgtggcaataaagtgtttattgattttttacgc
aatgattatgccatgacagcaatcacaccctattctttacgagccagaaaaggagcgcct
atagcaacccctttggaatgggaagagttgaatgataattcattaacccctcgatcttat
catttaaaaaatatttttcagcgcttagagaaaaaaccaaatccctggaaaaacttcaac
cggtataaccgtaacatagatataaacgacctattcaagtaa

DBGET integrated database retrieval system