KEGG   Legionella longbeachae: LLO_1301Help
Entry
LLO_1301          CDS       T01183                                 

Gene name
hisB
Definition
(GenBank) histidinol-phosphatase/imisazoleglycerol-phosphate dehydratase
  KO
K01089  imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase [EC:4.2.1.19 3.1.3.15]
Organism
llo  Legionella longbeachae
Pathway
llo00340  Histidine metabolism
llo01100  Metabolic pathways
llo01110  Biosynthesis of secondary metabolites
llo01230  Biosynthesis of amino acids
Module
llo_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:llo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    LLO_1301 (hisB)
Enzymes [BR:llo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.15  histidinol-phosphatase
     LLO_1301 (hisB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     LLO_1301 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD PNK3P Hydrolase_like HAD_2 Hydrolase_6 Glyco_hydro_4C
Motif
Other DBs
NCBI-ProteinID: CBJ11661
Pasteur: llo1301
UniProt: D3HRY2
LinkDB All DBs
Position
complement(1547406..1548464)
Genome map
AA seq 352 aa AA seqDB search
MQKILFIDRDGTLIEEPYDFQVDSLDKIKLATGVIPSLLQLQKEGFRFVMVTNQNGIGTS
AFPEDAFLMCHEFTLDLFSSQGIYFDEIFICPHMPEDNCLCRKPKTGLLDQFIKETIIDK
KSSWVIGDRDSDRQLADNLGIKFLPINKAHGWEQTTRTILNNKRTGFIRRITQETTIELS
VLLDSDQISPINTPIPFFNHMLEQVAKHGGFNLELKANGDVEVDDHHLIEDTAIALGEAL
KDALGNKWGINRYGFTVPMDESLASIAIDIGGRGFCVFQGQFIREFVGGMATEMVPHFFN
SLANALGATIHIEVRGKNHHHMIEACFKSLGRALGQACAKTNNFLPSTKGVL
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaattttatttatcgatcgtgacgggactttaattgaagagccttatgatttt
caagttgattcattggataaaatcaaacttgcgactggagtaatcccctctttattgcaa
ctgcaaaaagaaggatttcgtttcgttatggtgacgaatcaaaatggtatcggtacgtct
gcattccctgaggatgcatttttaatgtgccatgaatttactttggatctcttttcctct
caaggtatttattttgatgaaatttttatttgcccacacatgcccgaagataattgtttg
tgtcgtaaacctaaaacaggcttgttggatcaatttataaaagagaccataattgacaaa
aaatcttcctgggttattggtgatagagattctgatcgccaattagcggataatttaggg
ataaagtttttaccaatcaacaaagcacatggatgggagcaaactaccagaacgatactt
aataataaacgtactggatttattagaagaataacccaagaaacaacaatcgaattatca
gtgttattagattctgatcaaatcagccctatcaacacccccatccccttttttaaccat
atgctcgaacaagtggcaaaacatggtggatttaatctggaattaaaggctaatggggat
gtagaagttgatgatcatcatttaatcgaggataccgcaattgctttaggagaagccctc
aaagatgcccttggtaacaaatggggcattaatcgctatggttttactgtgcctatggat
gaatccctcgcctctatcgcaatagatataggtggtagaggtttttgcgtgttccaagga
caattcattcgtgagtttgttggcggtatggctacagaaatggtacctcatttttttaat
tcactcgccaatgctttaggtgcgacgattcacattgaagttaggggtaaaaatcatcac
catatgatagaagcctgctttaaatcactgggtagggcattaggccaagcgtgtgcaaaa
acaaataattttttaccatcgacgaagggggttctatga

DBGET integrated database retrieval system