KEGG   Legionella longbeachae: LLO_1982Help
Entry
LLO_1982          CDS       T01183                                 

Definition
(GenBank) putative zinc-dependent metallopeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
llo  Legionella longbeachae
Brite
KEGG Orthology (KO) [BR:llo00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:llo01002]
    LLO_1982
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llo04147]
    LLO_1982
   04090 CD Molecules [BR:llo04090]
    LLO_1982
Enzymes [BR:llo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     LLO_1982
Peptidases [BR:llo01002]
 Metallo Peptidases
  Family M2
   LLO_1982
Exosome [BR:llo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LLO_1982
CD molecules [BR:llo04090]
 Proteins
  LLO_1982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M3
Motif
Other DBs
NCBI-ProteinID: CBJ12366
Pasteur: llo1982
UniProt: D3HIY5
LinkDB All DBs
Position
complement(2330243..2332060)
Genome map
AA seq 605 aa AA seqDB search
MKHYYKIILISSYLLLSCQNSGSNLNTNAAEAQKFIDNYTKQYVQFYTSAKNARWQSNIE
IKPNDFTNTKIAQKADKALAVFVGSKENIKGAQKYLNPKYKLTKIQVKQLELILYSAANS
PQEVAELVEKRIQAEVEQIYKLYGYQYKLDGKKIGVNHIDCILKKESNLNKRLSAWEASK
QVGPTLKAGLINLRNLRNQTVQALGYPDFFTYQVNSYHMSTDEMMQTLEGLMRELYPLYR
ELHTWMRYELAKRYGVNTVPKYLPAHWLPNRWGQDWSSMLKDKSINIDDILKNKSPDWIM
KSAESLYVSLGYPKLPATFWKKSNLYPYPSNSSIKKNNHASAWHIDLNQDIRIIMSLESN
AKSFRTAHHELGHIYYYLTYTNKDVPPLLRKGANRAFHEAIGTMMGLAARKKPYLVERGL
IDNSVEIDNMYTLLKEALNSVVFIFFSAGTMSHFEKAMYVDNLSPDQFNVKWWELAKKYQ
GIEPPFIRGEEYCDAATKTHINNDPAQYYDYALSYVLLYQLHNHIAKNILHQDPHATNYF
GQQAIGDFLLHIMRHGASKDWREVLKESTGDELSAKAMLEYFQPLVEWLHEQNKGRNYSL
PEIMV
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgaaacattattataaaataatactgatttcatcttacctgcttttatcttgccaaaat
agtggtagtaacctcaataccaacgcggcagaggcacagaaatttattgataattacacc
aaacagtatgtacagttttacacgagtgctaaaaatgcacgatggcaatcaaatattgag
ataaaacccaatgattttactaatacgaagattgcacagaaagcggataaagctctcgct
gtctttgtcggtagtaaagagaacatcaagggtgcccaaaaataccttaatccaaaatat
aagctaacaaagatacaagtaaagcaattggagctaattctctattctgctgctaatagc
cctcaagaagtagctgagcttgtggaaaaaagaatacaggcagaggttgagcaaatatat
aagctatatggatatcaatataaactggatggcaaaaagataggtgttaatcatatagac
tgtattcttaaaaaagaatccaatctcaataaacgtctgtcagcatgggaagcaagtaaa
caagttggacctactctcaaggcaggtcttatcaatttacgcaacttaagaaatcaaacg
gtacaggcgttagggtaccctgattttttcacatatcaggtaaacagctaccatatgagc
accgacgaaatgatgcagactttggagggtttgatgagggagctctatcctctataccgc
gaactgcatacctggatgcgttatgaacttgctaaaagatatggtgtaaacactgtgccg
aaatatctgcccgcacactggctaccaaaccgctgggggcaggactggagttctatgttg
aaggataaaagcattaatattgatgatatccttaaaaacaaatcgcctgattggattatg
aagtcagcagaaagtctatatgtaagccttggttatcccaaactaccggcaacattttgg
aaaaagtcaaatctttatccctatccctccaattcatccattaaaaagaataaccatgca
tctgcatggcacattgaccttaatcaagatatacgaatcataatgagtctggagtctaat
gccaagtcgttcaggactgcgcaccatgagttgggtcatatctattactacctcacttat
actaacaaagacgttccgccactgttacgaaaaggggctaaccgtgcctttcatgaagct
attggtaccatgatggggcttgctgccaggaagaagccttatttggtggagcgtggtttg
atcgataattccgtagaaatagataatatgtatactcttcttaaagaagcgctcaactct
gtagtgtttatttttttctctgcgggcacgatgagccattttgaaaaagccatgtatgtt
gataatttatctccggaccagttcaacgtaaagtggtgggagctggctaagaaatatcaa
ggaattgagccaccatttattcgaggtgaagaatattgcgatgcagccactaaaacacat
atcaacaacgatcctgcccaatattatgattatgcattgtcttatgtcctcttatatcag
ctgcacaaccacatagccaagaatatacttcaccaagatcctcatgcgaccaactacttt
ggccagcaagctataggagactttctactgcatatcatgcgccatggagcgtctaaggac
tggagggaggtactcaaagagtcaactggtgatgagctgagtgccaaagcgatgttagaa
tactttcaacccctggttgagtggcttcatgaacagaataaaggaagaaattatagtctt
ccggaaattatggtataa

DBGET integrated database retrieval system