KEGG   Lactococcus lactis subsp. cremoris A76: llh_1025Help
Entry
llh_1025          CDS       T01965                                 

Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00220  Arginine biosynthesis
llr00250  Alanine, aspartate and glutamate metabolism
llr00290  Valine, leucine and isoleucine biosynthesis
llr01100  Metabolic pathways
llr01110  Biosynthesis of secondary metabolites
llr01130  Biosynthesis of antibiotics
llr01210  2-Oxocarboxylic acid metabolism
llr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:llr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    llh_1025
   00290 Valine, leucine and isoleucine biosynthesis
    llh_1025
   00220 Arginine biosynthesis
    llh_1025
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:llr01007]
    llh_1025
Enzymes [BR:llr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     llh_1025
    2.6.1.66  valine---pyruvate transaminase
     llh_1025
Amino acid related enzymes [BR:llr01007]
 Aminotransferase (transaminase)
  Class I
   llh_1025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEU39381
UniProt: G8P4D8
LinkDB All DBs
Position
197175..198389
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVINDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtttgaaaaatcgcataaacttgataatgtcagctatgatattcgtggtcca
gtgcttgatgaagcacagcgtatgcgagccaatggtgaaaaaattcttcggttgaataca
ggaaatccagcggaatttggttttcttgccccagacgaagtgattaacgatttgattcag
catgctgtggatagcgaaggttattcagattctaaaggtattttctcggctcgtaaggcg
attatgcaatactgtcaacttaaaggcttccctaatctggatatcaatgacattttcact
ggtaacggtgtttctgaattaatcgttatggctatgcaaggccttttggatacgggtgat
gaggttttgatccctatgcctgattatccgctctggacggcttctgtcagcttagctggg
ggaacagcggttcactatctctgcgatgaacaagctggatggtttccggatattgatgat
attcgctcaaaaattactagtaatactaaagccattgttttaattaatcctaataatcca
acgggtgcgctgtattctaaagatttattacttgaaattgtccaagtggctagagaaaat
aatttaattatcttttcggatgagatttatgaccgtttggtcatggacggcgctgttcat
gttccgattgccagcttagcacctgacctttttgtggtcacaatgaatggactttccaag
tcacatcgtattgctggatttcgtgtgggctggatggttctgtcaggtgagaaatcgcat
gtcaaaggctatatcgaaggcttgaacatgctcgcttcaatgagactttgttcaaatgtt
ttagctcagtctgttgtgcaaacctcacttggtgggactcaatctgttgataagctgctt
ttgccagggggacgagtttatgaacaaagagaattcatttataaagccattaatgatatt
ccaggattgtctgccgtgaagccacaagctgctttctatattttccctaaaattgacaga
gaaatgtataaaattgataatgatgaacaatttgttttagactttttaaaacaggaaaag
atacttcttgttcatggtcgaggattcaattggaaagatcctgatcattttcggattgtc
tatctgcctcgtgtagatgaactggcggaaatacaggaaaaaatggaacgctttttatgg
cagtatcgtaaataa

DBGET integrated database retrieval system