KEGG   Lactococcus lactis subsp. cremoris A76: llh_7475Help
Entry
llh_7475          CDS       T01965                                 

Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
llr  Lactococcus lactis subsp. cremoris A76
Pathway
llr00564  Glycerophospholipid metabolism
llr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    llh_7475
Enzymes [BR:llr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     llh_7475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_3 Pyr_redox_2 HI0933_like Pyr_redox NAD_binding_8 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEU40671
UniProt: G8P4M2
LinkDB All DBs
Position
1394675..1396252
Genome map
AA seq 525 aa AA seqDB search
MSISRQKNIEYLKANPDDWDFIIIGGGATGLGVAVDAASRGYKTVLVEQSDFAKSTSSRS
TKLVHGGVRYLAQGDVSLVREALHERGRLARNGPHLVKNQKFIIANYKAWEQPFYSIGMK
MYDALAGKLNIGKSKIYSKKKVAEAIPQIKHEHLVGGVMYYDGQFDDARMAINLMQTATE
QGALLVNYVKVTELVKTNSKVSSVKLHDELSGESFELHGKSIINATGIFVDQIMSMDTKE
HKPSVRPSQGVHLIVDGSFLGGQDAIMVPKTSDGRVLFCVPWHNKVILGTTDTPLTEFVL
EPRPLEEEIDFILETAGQYLEKKPERKDVLTAYAGLRPLAAPKEGDGEKTKEISRSHKLF
TSESGLVTITGGKWTTYRQMAEETVDLAIKTSKLPEKKCITRTLKIHGAKETTERERQNW
LYVYGSDKGKILALQNEDSSLALPLHPKYEFTGSEVIWAVREEMAQTLDDVLARRIRALF
LDARIAKEMAPKVAQLMAKEMGKDEAWEKEQVESFLALADGYILK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtctatctctcgtcaaaaaaatattgaatatttaaaagcaaatcccgatgattgggac
ttcattattatcggtggtggagcaaccggacttggagttgcggttgatgccgcatcacgc
ggttataaaacagttctagttgaacaaagtgactttgcaaaatcaacttcaagccgctcg
acaaaacttgttcacggtggcgttcgctaccttgctcaaggagatgtcagccttgttcgt
gaagcattacatgaaagaggtcgccttgctcgcaacggtccccatcttgtaaaaaatcaa
aaatttatcattgccaattacaaagcttgggagcaaccattttatagcatcggaatgaaa
atgtatgatgctttggcaggtaaattgaatattggaaaatcaaaaatttattctaagaaa
aaagttgctgaagcaattcctcaaatcaaacatgaacatctcgtcggaggagtcatgtat
tatgacggacaattcgatgatgctagaatggctatcaaccttatgcaaactgccactgaa
caaggtgcgctactagttaattatgtcaaagtgactgagcttgttaaaacgaactcaaaa
gtatcttctgttaaacttcatgatgaactttctggcgaatcatttgaacttcacggaaaa
tccatcatcaacgctacaggaatctttgttgaccaaattatgtcaatggataccaaagaa
cacaagccctctgttcgtccttcacaaggcgtccacctcattgttgacggctcatttctc
ggtggtcaagatgccattatggttccaaaaacttctgacggtcgtgtcttgttctgtgtc
ccttggcacaataaagtaatcttaggaacgacagatacacctcttacagaattcgtttta
gaacctcgaccccttgaagaagaaattgatttcatcttagaaactgctggtcaatattta
gaaaagaaacccgaacgtaaagatgttttaactgcttatgctggtttacgtccacttgcc
gctcccaaagaaggtgatggcgaaaaaacgaaagaaatttcaagaagtcataaactcttc
acctctgaatcaggactggtcacaattactgggggaaaatggacaacttatcgccaaatg
gccgaagaaactgttgatttagcaatcaaaacctctaaacttcctgaaaaaaaatgtatc
accagaacattgaaaatacatggggccaaagaaacaactgaaagagaacgtcaaaactgg
ctctatgtttacggttctgataaaggaaagattttagctctccaaaatgaagactcttct
ttagccttacctcttcacccaaaatacgaatttacaggttctgaagtcatctgggctgtc
cgtgaagaaatggctcaaactctagatgatgttctcgctcgtcggattcgtgcacttttc
cttgatgcaagaattgccaaagaaatggctcccaaagtcgcccaactgatggcgaaagaa
atgggtaaagatgaagcatgggaaaaagaacaagttgagagcttccttgctttagctgat
ggttatattttaaaataa

DBGET integrated database retrieval system