KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_0124Help
Entry
lilo_0124         CDS       T02485                                 

Gene name
aspC
Definition
(GenBank) aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
lls00220  Arginine biosynthesis
lls00250  Alanine, aspartate and glutamate metabolism
lls00290  Valine, leucine and isoleucine biosynthesis
lls01100  Metabolic pathways
lls01110  Biosynthesis of secondary metabolites
lls01130  Biosynthesis of antibiotics
lls01210  2-Oxocarboxylic acid metabolism
lls01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lls00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lilo_0124 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    lilo_0124 (aspC)
   00220 Arginine biosynthesis
    lilo_0124 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lls01007]
    lilo_0124 (aspC)
Enzymes [BR:lls01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     lilo_0124 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     lilo_0124 (aspC)
Amino acid related enzymes [BR:lls01007]
 Aminotransferase (transaminase)
  Class I
   lilo_0124 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAL50126
UniProt: H5SWB2
LinkDB All DBs
Position
136092..137306
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVISDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWKEPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatttgaaaaatcgcataaacttgataatgtcagctatgatattcgtggtcca
gtattggatgaagcacaaagaatgcgagccaatggtgaaaaaattcttcgattgaataca
ggaaatccagctgaatttggctttcttgctcctgatgaagtcattagtgacttgattcaa
catgctgtggatagcgaaggatattcagattctaaagggattttctcggctcgtaaagcg
attatgcaatactgtcagctcaagggttttcctaatcttgatatcaatgatattttcaca
ggtaatggggtttctgaattgattgttatggccatgcagggacttttggacacaggggat
gaggttttgattcctatgcctgattatccactttggacggcttctgtcagcttagctgga
ggaacagctgttcattacctctgtgatgaacaggctggttggttccctgacattgatgat
attcgctcaaaaatcacaagtaatacaaaagccattgttttgattaatcctaataatcca
acgggtgcgctgtattctaaagatttattgcttgaaattgttcaagtggctagagaaaat
aatttaattattttctctgacgaaatttatgaccgattggttatggatggagcagttcat
gttccgattgctagcttggcaccagatctttttgtggtcacaatgaatggcctctcaaaa
tcacaccgcattgcgggattccgcgtggggtggatggttctgtcaggtgaaaaatcacat
gtcaagggttatattgaaggtttgaatatgctggcttcaatgcgactttgttccaatgtt
ttagctcaatcagtcgtacaaacttcacttggtggcactcaatcggttgataaattgctg
ttgccgggtggacgagtttatgaacaaagagaattcatttataaagccatcaatgatatt
ccaggattatctgcggtcaaacctcaagcagctttctatattttccctaaaattgacaga
gaaatgtataaaattgataatgatgaacaatttgtcttggactttttgaagcaggaaaaa
atcctgcttgttcatggtcgaggatttaattggaaagagccagaccatttccgaattgtt
tatctgcctcgtgtggacgaattagcggaaatacaagaaaaaatggaacgtttcctttgg
caatatcgtaaataa

DBGET integrated database retrieval system