KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_0127Help
Entry
lilo_0127         CDS       T02485                                 

Gene name
gatA
Definition
(GenBank) Glu-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
lls00970  Aminoacyl-tRNA biosynthesis
lls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lls00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    lilo_0127 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lls03029]
    lilo_0127 (gatA)
Enzymes [BR:lls01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     lilo_0127 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     lilo_0127 (gatA)
Mitochondrial biogenesis [BR:lls03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    lilo_0127 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAL50129
UniProt: H5SWB5
LinkDB All DBs
Position
139199..140659
Genome map
AA seq 486 aa AA seqDB search
MSYNNKSIKELHELLVNKEISALELTKATLSDISAREPQIDAFLKITEEKALQDAAAIDA
RGINPDVVTDGISIAVKDNIVTEGIETTAASKILGGWIPPYNATVANKLSESGLITIGKL
NMDEFAMGGSGENSSVKPTKNAWDQTKVPGGSSSGSAASVASGQVRLSLGSDTGGSIRQP
AAFNGIVGLKPTYGRVSRFGLIAFASSLDQIGPLAPTVEENAQLLNVISGFDKNDSTSSN
VAVPDFTSKIGQDIKGMKIALPKEYFGEGIDEKVKEQILAAAKHLEKLGAIVEEVSLPHS
KYGVAVYYIIASSEASSNLQRFDGIRYGYRAQDIKNLEDLYVKSRSEGFGPEVQRRIMLG
TFSLSAGSYDKHFKKAGQVRTLIINDFAKVFEKYDLILGPTTPTPAWDLGARVDDPLSMY
LADLLTIPVNLAGLPGISIPAGFADGLPVGMQLIGKRYDEETIYQVAAAFEATTDFHKKQ
PIIFGK
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacaataacaaatcaatcaaagagcttcatgagctacttgtaaataaagaaatt
tctgctcttgaactgacaaaagcaacgctttctgatatttctgcacgtgaaccacaaatt
gatgcttttttgaaaattacagaagaaaaagctttgcaagatgccgccgcaattgatgct
cgtggaattaatccagacgttgtgactgacggaatctcaattgctgtcaaagataatatt
gttacagaaggaattgaaacaacagctgcttcaaaaattcttggaggttggattccacct
tataatgcaacggttgcgaataaattgagcgaatctgggttaattacaattggtaaactc
aatatggacgagtttgcgatgggtggttctggtgaaaattcttcagttaagccaaccaaa
aacgcttgggatcaaacaaaagtacctggtggttcttcatctggttctgcggcttcagtt
gcttctggtcaagttcgtttatcattgggttcagatacgggtggctcaattcgccaacct
gccgcattcaatgggattgttggtttgaaaccaacttatggtcgtgtgagtcgttttggt
ttgattgcttttgcttcatcattagaccaaatcggtccattggcgccaacagtcgaagaa
aatgctcaacttttgaatgtcatttctggctttgataaaaatgatagcacatcatcaaat
gttgcagttcctgactttacaagtaaaattggtcaagatattaagggaatgaaaattgct
ttgcctaaagaatattttggtgaaggaattgatgaaaaagtaaaagaacaaattttggca
gcagctaaacatttggaaaaattgggtgccatcgttgaagaagtgagtcttcctcacagt
aaatatggtgttgccgtttattatattattgcctcttctgaagccagctcaaatcttcaa
cgttttgatggtattcgttacggttatcgtgcacaagacatcaaaaatcttgaagatttg
tatgtaaaatcacgttctgaaggatttggtccagaagttcaacgtcgaattatgttagga
acttttagtctttcagcaggttcttatgataaacatttcaaaaaagcaggtcaagttcgt
actttaatcatcaatgattttgcaaaagtttttgaaaaatatgatttaatcttaggccca
acaactccgacaccagcttgggacttgggagcacgtgttgatgatccactttcaatgtat
ttggcggatttattgacaattccagtcaacctagctggacttccaggaatttcaattcct
gctggttttgccgatggactacctgtgggaatgcaattgattggtaaacgttacgatgaa
gaaacgatttaccaagtagcggctgcttttgaagcaactactgatttccacaaaaaacaa
ccgattatttttggaaaataa

DBGET integrated database retrieval system