KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_0305Help
Entry
lilo_0305         CDS       T02485                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Brite
KEGG Orthology (KO) [BR:lls00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    lilo_0305 (ahpF)
Enzymes [BR:lls01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     lilo_0305 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 FAD_binding_3 Thi4 DAO AlaDh_PNT_C Glutaredoxin NAD_binding_8 K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: BAL50306
UniProt: H5SWU2
LinkDB All DBs
Position
322047..323594
Genome map
AA seq 515 aa AA seqDB search
MTERFNMILDENLRAQLMPYMDLLENPIILKVDADLESENGKKIAEFTDELASLSEMISK
ETAKLNRKTAFSIEREGVSGVLFSGLPLGHELNSLVLALVQVSGRPPRIEQELVERIQAI
QNPLHFETYVSLTCHNCPDVVQALNTMSILNPNISHTMIEGGMFQEEVEAKGIMAVPTVF
KNGEEFHNGRASLEELLEKITGPESSEAFSDKDPYDVLVVGGGPAGASAAIYAARKGIRT
GLIAERFGGQPLETLGIENLIGTPYVEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDL
IEVSLENGALLKSKSVIISTGARWRDLGIPGEQEFKTKGVAYCPHCDGPLFAGKDVAVIG
GGNSGIEAAIDLAGLVRHVTVLEFLPELKADKILQEKLATLNNVTVLTNVETKEILGDDK
VRGLNYQVRGSKETVHLELAGVFVLIGLVPNTQWLEGTIDLSARGEILTDKVGATNLPGV
FAAGDCTDSVYKQIIISMGTGATASLGAFDYLIRN
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgacagaaaggtttaatatgatattagatgaaaatcttcgtgctcagttgatgccttat
atggatttgttggaaaatccaattattttaaaagttgatgcagatttagagagcgaaaat
gggaaaaaaatagcagaatttacagatgaacttgcaagtttgtccgaaatgatttcaaaa
gaaacagcaaaactcaatcgaaaaacagctttttctattgaaagagaaggtgtttctgga
gtccttttttcagggctaccattaggtcatgagttgaattcattggtcttggcgcttgtc
caagtaagtggacgccctccacggattgaacaagaattagttgagcgaattcaagcgatt
caaaatccacttcactttgaaacctatgtgagtttaacttgtcataactgtccagatgtt
gtccaagcattaaacacaatgagtattctcaaccccaatattagtcacacaatgattgaa
gggggaatgtttcaagaagaagtggaagcaaaaggaattatggcggttccaactgttttc
aaaaatggtgaagaatttcataatggacgagctagtcttgaagaattactagaaaaaatt
actggtccagagagttcggaagctttttctgataaagacccttatgatgttttagttgtt
ggtggaggtcctgctggcgcaagtgcagctatttatgctgcgcgtaaagggattcggaca
ggcttaatcgctgaacgctttggtggtcaaccactagaaactttaggaattgaaaacctt
attggaacgccttatgttgaaggggttcaacttggtcgtcagcttgaagaacatgtgaaa
aaataccctgttgatttgatgaacttgcaaaaagcagttaagctagagaaaaaagatttg
attgaggtgagtcttgaaaatggcgcccttctaaaaagtaagtcagttattatttcaacg
ggcgctcgttggcgagatttgggaattccaggagagcaagaatttaaaaccaaaggagtc
gcttactgcccacattgtgatggtcctttgtttgcaggaaaagatgtagcggttatcggt
ggaggaaattcaggaatcgaagcagctattgatttagctggtttggttagacatgttact
gttcttgaatttttacctgaacttaaagcagataaaattttacaagaaaaacttgcgacc
ctaaataatgttactgtcctcaccaatgtagaaaccaaagagattttaggggatgacaag
gttagaggtttgaattatcaagttcgcggctctaaagaaactgttcatttggaacttgct
ggtgtctttgttttaattggtttagttccgaatactcagtggttggaaggaacaattgac
ttatccgcacgtggagaaattttgactgataaagttggagcaacaaatcttcctggtgtt
tttgcagcgggagattgtacggatagtgtttataagcaaattattatttcaatggggact
ggggcaaccgcttctctaggtgcttttgattatttgataagaaactaa

DBGET integrated database retrieval system