KEGG   Lactococcus lactis subsp. lactis IO-1: lilo_0479Help
Entry
lilo_0479         CDS       T02485                                 

Gene name
yfiG
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lls  Lactococcus lactis subsp. lactis IO-1
Pathway
lls00240  Pyrimidine metabolism
lls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lls00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    lilo_0479 (yfiG)
Enzymes [BR:lls01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     lilo_0479 (yfiG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: BAL50480
UniProt: H5SXB6
LinkDB All DBs
Position
515301..515870
Genome map
AA seq 189 aa AA seqDB search
MAQLYFKYGTMNSGKSIEILKVAHNYEEQGKPVLLMTSSLDTRAGVGTVASRIGMKAEAV
AIDEEMSVFDYVNSLSAKPFCVLIDEAQFLNKKHVYDFARVVDELNVPVMAFGLKNDFRN
ELFEGSKYLLLLADKIEEIKTICWYCSKKATMVIRTIDGKPVYEGEQLQIGGNETYIPVC
RKHYFKPEI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaattatatttcaaatatgggacgatgaattcaggaaaatcaattgagattttg
aaagtggctcataattacgaggaacaggggaagcctgttttattaatgacttctagtctg
gatacacgcgcaggggttgggacagttgctagtcgaatcgggatgaaagctgaagctgtc
gcaattgatgaggaaatgtctgtttttgattatgtgaacagcctgtctgctaaacctttt
tgtgtgctgattgatgaggcacaatttttaaataaaaaacatgtctatgattttgctcgt
gttgtggatgaactaaatgttccagtcatggcttttggtttgaaaaatgattttcgtaat
gagctttttgaaggctcaaaatatttacttttgcttgcagataaaatcgaagaaattaaa
acgatttgttggtattgtagtaaaaaggcaacaatggtgattcggacaattgatggaaaa
ccagtttatgaaggtgaacagttgcaaattggtggaaacgaaacctatattcctgtttgt
cgtaaacattattttaagccagaaatttaa

DBGET integrated database retrieval system