KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_0141Help
Entry
CVCAS_0141        CDS       T01964                                 

Gene name
gatA
Definition
(GenBank) aspartyl-tRNA Asn/glutamyl-tRNA Gln amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Pathway
llt00970  Aminoacyl-tRNA biosynthesis
llt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llt00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CVCAS_0141 (gatA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:llt03029]
    CVCAS_0141 (gatA)
Enzymes [BR:llt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CVCAS_0141 (gatA)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CVCAS_0141 (gatA)
Mitochondrial biogenesis [BR:llt03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CVCAS_0141 (gatA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ADZ62809
LinkDB All DBs
Position
147256..148722
Genome map
AA seq 488 aa AA seqDB search
MSYNNKSIKELHELLVNKEISALELTKATLSDISAREPQIDAFLKITEEKALQDAAAIDA
RGINPDVVTDGISIAVKDNIVTEGIETTAASKILGGWIPPYSATVANKLSESGLITIGKL
NMDEFAMGGSGENSSVKPTKNAWDQTKVPGGSSSGSAASVASGQVRLSLGSDTGGSIRQP
AAFNGIVGLKPTYGRVSRFGLIAFASSLDQIGPLAPTVEENAQLLNVISGFDKNDSTSSN
VAVPDFTSKIGQDIKGMKIALPKEYFGEGIDEKVKEQILAAAKHLEKLGAIVEEVSLPHS
KYGVAVYYIIASSEASSNLQRFDGIRYGYRAQDIKNLEDLYVKSRSEGFGSEVKRRIMLG
TFSLSAGSYDKHFKKAGQVRTLIINDFAKVFEKYDLILGPTTPTPAWDLGARVDDPLSMY
LADLLTIPVNLAGLPGISIPAGFADGLPVGMQLIGKRYDEETIYQVAAAFEATTDFHKKQ
PIIFGKVQ
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacaataacaaatcaatcaaagagcttcatgagctacttgtaaataaagaaatt
tctgctcttgaactgacaaaagcaacgctttctgatatttctgcacgtgaaccacaaatt
gatgcttttttgaaaattacagaagaaaaagctttgcaagatgccgccgcaattgatgct
cgtggaattaatccagacgttgtgactgacggaatctcaattgctgtcaaagataatatt
gttacagaaggaattgaaacaacagctgcctcaaaaattcttggaggttggattccacct
tatagtgcaacggttgcgaataaattgagcgaatctgggttaattacaattggtaaactc
aatatggatgagtttgcgatgggtggttctggtgaaaattcttcagttaagccaaccaaa
aacgcttgggatcaaacaaaagtacctggcggttcttcatctggttctgcggcttcagtt
gcttctggtcaagttcgtttatcattgggttcagatactggtggctcaattcgccaacct
gccgcattcaatggtattgttggtttgaaaccaacttatggtcgtgtgagtcgttttggt
ttaattgcttttgcttcatcattagaccaaatcggtccattggcgccaacagtcgaagaa
aatgctcaacttttgaatgtcatttctggctttgataaaaatgatagtacatcatcaaat
gttgcagttcctgactttacaagtaaaattggtcaagacattaaaggaatgaagattgct
ttgcctaaagaatattttggtgaaggaattgatgaaaaagtaaaagaacaaattttggca
gcagctaaacatttggaaaaattgggtgccattgttgaagaagttagtcttcctcacagt
aaatatggtgttgcagtttattatattattgcctcttctgaagccagctcaaatcttcaa
cgttttgatggtattcgttacggttatcgtgcacaagacatcaaaaatcttgaagatttg
tatgtaaaatcacgttctgaaggatttggttcagaagttaaacgtcgaattatgttagga
acttttagtctttcagcaggttcttatgataaacatttcaaaaaagcaggtcaagttcgt
actttaatcatcaatgattttgcaaaagtttttgaaaaatatgatttaatcttaggccca
acaactccgacaccagcttgggacttgggagcacgtgttgatgatccactttcaatgtat
ttggcggatttattgacaattccagtcaatctagctggccttccaggaatttcaattcct
gctggttttgccgatggactacctgtgggaatgcaattgattggtaaacgttacgatgag
gaaacgatttatcaagtagcggcggcttttgaagcaactactgatttccacaaaaaacaa
ccgattatttttggaaaggtgcaataa

DBGET integrated database retrieval system