KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_0323Help
Entry
CVCAS_0323        CDS       T01964                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Brite
KEGG Orthology (KO) [BR:llt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CVCAS_0323 (ahpF)
Enzymes [BR:llt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CVCAS_0323 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 FAD_binding_3 Thi4 DAO AlaDh_PNT_C Glutaredoxin NAD_binding_8 K_oxygenase Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: ADZ62988
LinkDB All DBs
Position
323828..325357
Genome map
AA seq 509 aa AA seqDB search
MILDETLRAQLMPYMDLLENPIILKVDADLESENGKKIVEFTDELASLSEMISKETAKLN
RKTAFSIEREGVSGVLFSGLPLGHELNSLVLALVQVSGRPPRIEQELVERIQAIQNPLHF
ETYVSLTCHNCPDVVQALNTMSILNPNISHTMIEGGMFQEEVEAKGIMAVPTVFKNGEEF
HNGRASLEELLEKITGPESSEAFFDKDPYDVLVVGGGPAGASAAIYAARKGIRTGLIAER
FGGQPLETLGIENLIGTPYVEGVQLGRQLEEHVKKYPVDLMNLQKAVKLEKKDLIEVSLE
NGALLKSKSVIISTGARWRDLGIPGEQEFKTKGVAYCPHCDGPLFAGKDVAVIGGGNSGI
EAAIDLAGLVRHVTVLEFLPELKADKILQEKLATLNNVTVLTNVETKEILGDDKVRGLNY
QVRGSKETVHLELAGVFVLIGLVPNTQWLEGTIDLSARGEILTDKVGATNLPGVFAAGDC
TDSVYKQIIISMGTGATASLGAFDYLIRN
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgattttagatgaaactcttcgtgctcagttgatgccttatatggatttgttggaaaat
ccaattattttaaaagttgatgcagatttagagagcgaaaatgggaaaaaaatagtagaa
tttacagatgaacttgcaagtttgtccgaaatgatttcaaaagaaacagcaaaactcaat
cgaaaaacagctttctctattgaaagagaaggtgtttctggagtccttttttcagggcta
ccattaggtcatgagttgaattcattggtcttggcgcttgtccaagtaagtggacgccct
ccacggattgaacaagaattagttgagcgaattcaagcgattcaaaatccacttcacttt
gaaacttatgtgagtttaacttgtcataactgtccagatgttgtccaagcattaaacaca
atgagtattctcaaccccaatattagtcacacaatgattgaggggggaatgtttcaagaa
gaagtggaagcaaaaggaattatggcggttccaactgttttcaaaaatggtgaagaattt
cataatggacgagctagtcttgaagaattactagaaaaaattactggtccagagagttcg
gaagctttttttgataaagacccttatgatgttttagttgttggtggaggccctgctggt
gcaagtgcagctatttatgctgcacgtaaagggattcggacaggtttaatcgctgaacgc
tttggcggtcaaccactagaaactttaggaattgaaaacctcattggaactccttatgtt
gaaggagttcaacttggtcgtcagcttgaagaacatgtgaaaaaatatcctgtcgatttg
atgaacttgcaaaaagcagttaagctagagaaaaaagatttgattgaggtgagtcttgaa
aatggggcacttctaaaaagtaagtcagtcattatttcaacgggcgctcgttggcgagat
ttgggaattccaggagagcaagaatttaaaaccaaaggagtcgcttactgtccacattgt
gatggtcctttgtttgcaggaaaagatgtagcggttatcggtggcggaaattcaggaatc
gaagcagctattgatttagctggtttggttagacatgttactgttcttgaatttttacct
gaacttaaagcagacaaaattttacaagaaaaacttgcgaccctaaataatgttactgtc
ctcaccaatgtagaaacaaaagagattttaggagatgacaaggttagaggtttgaattat
caagttcgcggctctaaagaaactgttcatttggaacttgctggtgtctttgtattaatt
ggtttagttccgaatactcagtggttggagggaacaattgacttatccgcacgtggagaa
attttgactgataaagttggagcgacaaatcttcctggtgtttttgcagcgggagattgt
acggatagtgtttataagcaaattattatttcaatggggactggggcgaccgcttctcta
ggtgcttttgattatttaataagaaactaa

DBGET integrated database retrieval system