KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1093Help
Entry
CVCAS_1093        CDS       T01964                                 

Gene name
mutX
Definition
(GenBank) phosphohydrolase, MutT/NUDIX family protein
  KO
K03574  8-oxo-dGTP diphosphatase [EC:3.6.1.55]
Organism
llt  Lactococcus lactis subsp. lactis CV56
Brite
KEGG Orthology (KO) [BR:llt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:llt03400]
    CVCAS_1093 (mutX)
Enzymes [BR:llt01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.55  8-oxo-dGTP diphosphatase
     CVCAS_1093 (mutX)
DNA repair and recombination proteins [BR:llt03400]
 Eukaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    CVCAS_1093 (mutX)
 Prokaryotic Type
    CVCAS_1093 (mutX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NUDIX
Motif
Other DBs
NCBI-ProteinID: ADZ63741
LinkDB All DBs
Position
1120945..1121412
Genome map
AA seq 155 aa AA seqDB search
MTYHELEQVELTNMCAIIDEKNHKVLVQERKKSWTGIAFPGGHLEKGEALVPSTIREIKE
ETGLDITNLKLCGVKDWFEPEKNRRYMVFLYSTTEFSGQLINETDEGKVFWQDINQLANL
NLASSFLEMADMMLHSTYSEFVYEIDGEHWEKKFY
NT seq 468 nt NT seq  +upstreamnt  +downstreamnt
atgacttatcatgagttagaacaagtcgaattgacaaatatgtgtgccattattgacgaa
aaaaaccataaagttcttgttcaagagcgtaaaaaatcatggactggaattgcttttcct
ggaggacatctggaaaaaggtgaggctcttgttccgtcaacaataagagagattaaggaa
gaaactggacttgatatcacaaatttaaaactttgtggagttaaggattggtttgaacct
gagaagaacagaagatatatggtttttctttattcaacaacagaattctctggtcaatta
attaatgaaacagatgaaggaaaagttttttggcaagatattaatcaattagcgaatttg
aatcttgcaagtagttttcttgaaatggcagacatgatgcttcactcaacttactcagaa
tttgtttatgagattgatggagagcattgggaaaagaaattttattga

DBGET integrated database retrieval system