KEGG   Lactococcus lactis subsp. lactis CV56: CVCAS_1803Help
Entry
CVCAS_1803        CDS       T01964                                 

Gene name
divIVA
Definition
(GenBank) cell division initiation protein divIVA
  KO
K04074  cell division initiation protein
Organism
llt  Lactococcus lactis subsp. lactis CV56
Brite
KEGG Orthology (KO) [BR:llt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:llt03036]
    CVCAS_1803 (divIVA)
Chromosome and associated proteins [BR:llt03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Inhibitors of FtsZ assembly
    CVCAS_1803 (divIVA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DivIVA FTA4 V-ATPase_G_2 TSNAXIP1_N ZYG-11_interact
Motif
Other DBs
NCBI-ProteinID: ADZ64428
LinkDB All DBs
Position
complement(1874672..1875598)
Genome map
AA seq 308 aa AA seqDB search
MTLNSLDVQNKTFNPQFRGFSKHEVDEFLDIVVRDYDEFAQTIKDQERELKALRERVKYF
DDMKDSLNKSIVVAQDAADNLREQAKSEADTLRINSEKESADIIANAGQKSSLIIEAAKK
EAGFILNAASDDARKLVRDTDDLKRKMRLYHQRMTSIIENQLASIQSDDWAEIFRPTQDY
AINPEEKLQSIIEEHLENAESTLAKTQAIKPLTDEDIAQANETSDETETIVSEEIVFETE
VPDEVKEEVEITDEANTTDDSNEESEVEAPKADDSEIFPELDSKAPAETAEVVEKDNQET
IDLSELKN
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacattaaatagtttagatgttcaaaacaaaacttttaatccacaatttcgcggcttc
agtaaacatgaagttgatgaatttttggatatcgttgttcgagattatgatgaattcgct
caaacaattaaagatcaagaacgtgaattaaaggcgttacgcgaacgcgtgaaatatttt
gatgacatgaaagattcactgaacaagtcaattgttgttgctcaagatgctgctgataat
ctccgtgaacaagccaaaagtgaagctgatacgcttagaattaattctgaaaaagaatct
gctgatattattgcaaatgcaggacaaaagagttctttaattattgaagcggctaaaaaa
gaagctggatttattttgaatgctgcttctgatgatgcgcgtaaattagtacgtgatact
gatgatttgaaacgtaaaatgcgtctctatcaccaacgaatgacttcaattattgaaaat
caacttgcgtctattcaatcggatgactgggctgaaatctttagacctactcaagattat
gcaatcaatcctgaagaaaaattgcaatcaatcattgaagaacatttggaaaatgctgaa
tctactttggcaaaaactcaagcaattaaacctttaacagatgaagatattgcacaagca
aatgaaacatctgatgaaacagaaacaattgtttcagaggaaattgtttttgaaaccgaa
gtacctgacgaagtaaaagaagaagtagaaattactgacgaagctaatactactgatgat
tctaacgaagagtcagaagttgaagctccaaaagcagatgattcagaaattttcccagaa
ttagattcaaaagcaccagctgaaacagctgaggttgttgaaaaagataatcaagaaaca
attgatttaagcgaattaaaaaattaa

DBGET integrated database retrieval system