KEGG   Labilithrix luteola: AKJ09_01037Help
Entry
AKJ09_01037       CDS       T04033                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
llu  Labilithrix luteola
Pathway
llu00620  Pyruvate metabolism
llu00680  Methane metabolism
llu01100  Metabolic pathways
llu01120  Microbial metabolism in diverse environments
llu01200  Carbon metabolism
Module
llu_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AKJ09_01037
  09102 Energy metabolism
   00680 Methane metabolism
    AKJ09_01037
Enzymes [BR:llu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AKJ09_01037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AKU94373
UniProt: A0A0K1PLG3
LinkDB All DBs
Position
1037115..1039841
Genome map
AA seq 908 aa AA seqDB search
MANEGGEGAKGAVRTENASGSPMADPAAALRKDISDLGHMLGDTLVEQEGVGLLELEESI
RALAKERRKKGRRGPAAARMQALIEGLDTKTAERVARAFTHYFQLVNLSEQHHRTRRRHE
HARQGDLQLGSFEREIALVAKSVPRDAFEALLARTSVELVFTAHPSEAQRRTVLDKERHV
AHLLVRRDRLDATPAQNEELTLALREEITTLWQTDELRTVRPRVGEEVKNTLFYLEEVLF
PLIPKFYAELEHAARKAYGEGVRIPCILHFGSWVGADMDGNPNVTPEVALDTAYAQAARV
VGLYLREIDALGAALSQSTRRTTVSEELVQSIAKDAEALPELATELASVAREEPYRKKLR
FMKARLEARHEHLVEARRRGGPFLELPSYAYASPGALLADLDVIARSLDENRGALAGRRR
VCGLRRQIETFGFHLAKLDVRVPAAWVREAVVGDLLKPEKGPGIRAMEAVANIQKITAGQ
GAESFILSMSHGADDMRASLVLARACGLYRPKEGVATVSIVPLFEMLDDLERAAAEVERA
SQAPEYREYLALRGNLQELMVGYSDSNKDAGILSSSFALYRAQQELVEVAKRNDLKLKIF
HGRGGSIGRGGGPSQRAIESLPTGAIDGRFKLTEQGEVLGWKYLLSEIAERNLEVTTSGV
LRASSDTGAPDVQREFEAAFVDVAHDSLEAYRTLVHDSNFVRYYEESTPLDEIAMLNIGS
RPAHRKDQGQRRLEDLRAIPWVFAWTQSRQLVPGWFGAGRALTRLIAKRGVEFVRSMREK
WPFFASTLEAIAVSLAVADMDIAGRYASLVRDRALARRLFTRIALDHGRAVRAIRRIFDQ
STLLGHAPTLERSIALRNPYVDPLSFIQIELLRRKRAATSPSPQAETELERAVLLTINGI
AAGLRNTG
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgaggggggcgaaggcgcgaagggggcagttcgcacggagaatgcaagcggg
agccccatggccgaccccgccgccgccctgcgcaaggacatttcggacctcggccacatg
cttggcgacaccctcgtcgagcaagagggcgtcggactgctcgagctcgaggagtccatc
cgcgcactcgccaaggagcgccgcaagaaaggtcgccgcgggccagccgccgcacgcatg
caggcgctcatcgaagggctcgacacgaagacggccgaacgcgttgcgcgcgcgttcacg
cactacttccagctcgtcaatctctccgagcagcaccaccgaacgcgacgccggcacgag
cacgcgcgccaaggcgacctgcagctcggctcgttcgagcgcgagattgcgctcgtcgcg
aagagcgtccctcgcgacgcgttcgaggcgctgctggcgcgtacgtccgtcgagctcgtc
ttcaccgcgcaccccagtgaagcgcagaggcgtacggtgctcgacaaggagcggcacgtc
gcccacttgctcgtgcgacgcgaccgactcgacgccacgccggcgcagaacgaggagctc
accctcgccttgcgcgaggagatcaccacgctctggcagaccgacgagctccgcaccgtt
cgcccgcgcgtcggcgaggaagtgaagaacacgctcttctacctcgaagaggtgctcttt
ccgttgattcccaagttctacgccgagctcgaacacgcagcgcgtaaggcatacggcgaa
ggcgtccgcattccgtgcatcctgcactttggctcgtgggtcggcgccgacatggacggc
aacccgaacgtcaccccggaggtcgccctcgacacggcgtacgcgcaggccgcgcgcgtg
gtgggcctctatttgcgggagatcgacgctctgggcgccgccctctcacagagcacccgt
cgcacgacggtgagcgaagagctcgtccaatcgatcgccaaagacgccgaagctctcccc
gagctggcaaccgagctcgcgtccgtcgcgcgcgaggagccgtaccgcaagaagcttcgc
ttcatgaaggcgcgcctcgaggcaagacacgagcatctcgtggaggcccgacgccgcggg
ggcccctttctcgagctcccgtcgtatgcgtatgcctcgcccggagcgctgctcgccgat
ctcgacgtcatcgctcgctcgctcgacgagaaccgcggtgcgctcgccggaagaaggcgc
gtgtgcggcctgcgccgccaaatcgagaccttcggtttccatctcgccaagctcgacgtg
cgcgtccccgccgcctgggttcgtgaagccgtcgtgggcgacctgctgaagcccgaaaag
ggccccggcatccgcgcgatggaggccgtcgcgaacatccagaagatcaccgcgggccag
ggcgccgagtcgttcatcctcagcatgtcgcacggcgccgacgacatgcgtgcgtccctg
gttctcgcgcgggcctgtggtctttatcgccccaaggagggcgttgccaccgtctcgatc
gtgccgctcttcgagatgctcgacgatctcgaacgcgccgccgcggaggtcgaacgcgcc
tcgcaggcgcccgaataccgcgagtacctggcgctgcgcggcaacctgcaggagctgatg
gtcggctactccgactccaacaaggacgccggcattctctcgtcgtccttcgcgctctac
cgcgcgcagcaagagctcgtcgaggttgccaagcggaacgacttgaagctgaagatcttc
cacggacgcggcggttcgatcgggcgcggcggcggtccttcgcagcgcgccatcgagagc
ctgccgaccggcgccatcgacggacgcttcaagctcacggagcaaggcgaggtgctcggc
tggaagtacctcctctcggagatcgccgagcgcaatctcgaggtgacgacgagcggcgtc
cttcgcgcatcgagcgataccggcgcgcccgacgtgcagcgcgaattcgaagcggccttc
gtcgacgtcgcgcacgacagcctcgaggcctatcgcacgctcgtccatgattcgaacttc
gtgcggtactacgaggagtcgacgccgctcgacgagatcgcgatgctcaacatcggctcg
cgccccgcgcatcgcaaagatcaggggcagcggcgcctcgaagatctccgcgccatcccc
tgggtgttcgcctggacccagtcgcgccagctcgtccccggctggttcggcgcaggccgc
gcgctcacacggctcatcgccaagcgcggcgtcgagttcgtccggagcatgcgcgagaag
tggcccttcttcgcctcgaccctcgaagccatcgcggtctccctcgccgtcgccgacatg
gacatcgccggacgctatgcgtcgctcgtccgcgaccgcgccctcgcccgccggctcttc
acccggattgcgctcgaccacggccgtgctgtccgcgcgattcggaggatcttcgatcag
agcacgctgctcgggcacgccccgacgctcgagcgctcgatcgccctacgcaatccgtac
gtcgacccgctgagcttcatccagatcgagctcctccgccggaaacgcgcggcgacaagt
ccctctccgcaggccgaaaccgagctcgaacgggccgtccttttgaccatcaacggtatc
gccgccggattgcggaacacgggctag

DBGET integrated database retrieval system