KEGG   Labilithrix luteola: AKJ09_04321Help
Entry
AKJ09_04321       CDS       T04033                                 

Definition
(GenBank) Multimodular transpeptidase-transglycosylase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
llu  Labilithrix luteola
Pathway
llu00550  Peptidoglycan biosynthesis
llu01100  Metabolic pathways
llu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AKJ09_04321
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AKJ09_04321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:llu01003]
    AKJ09_04321
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:llu01011]
    AKJ09_04321
Enzymes [BR:llu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AKJ09_04321
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AKJ09_04321
Glycosyltransferases [BR:llu01003]
 Polysaccharide
  Bacterial polysaccharide
   AKJ09_04321
Peptidoglycan biosynthesis and degradation proteins [BR:llu01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AKJ09_04321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase SHOCT
Motif
Other DBs
NCBI-ProteinID: AKU97657
UniProt: A0A0K1PVV6
LinkDB All DBs
Position
complement(4435458..4438055)
Genome map
AA seq 865 aa AA seqDB search
MSSAAPGVPKNVRASSRPPEAPRESLLSQVVGAPKPKTDDSRRAKVLRIAKRWAIGLGIA
AAVLAMSAAVTGWLLVRHYEADLPSVAELERGYHPSQVTRVLARDGTLLAELFTERRTVV
RIDDLPPQVKLAVLAAEDANFYNHEGINYLGIARAFVVNLRAGRTRQGGSTITQQVIKNI
LLDTQERTYKRKMREALLARRLEQELCPSCGSDEEGKRRRKDKILELYLNHIYLGGGRYG
IEEAAKYNFGKSARELTVAEAAMLAGVPAGPEIYSPKRDLKRALSRREFVLGQMRAKGFL
NDAQYEAAKDEPVRLSPSQEVESELAPEAVTLAKKLLFELEPDRGPRGGFTITTTIDPHV
QAAARKASRENVQAYDKRHGLLAPFKAAAVASTKGKKAPAQVPVFEGTPNFEAHKVLTGA
VIGHDDLTGTIDVRVGTVTGSIKLADYKRYNPQNLAPSQFAEVGARLRVSLLAPVPTEKG
DGETPHEKAIANAKVPLRLELGPETASVVVDVRTRQILSIVGSYEGTSGGLDRSSQSRRQ
PGSTFKPIVYSYAIHARRYTPASLIDIQPTTFAGGYKPSNYEGYAGSDPLRLREVLANSV
NIGAVRVLEDVGPASVVDWAKALGISSALKPDLSLALGSYEVHPSELVAAYATFAAGGMY
EEPRLVTRIVGPDGKDVALKEPPPPRRVLEPAEAYVTTSMLQSVVDHGTATRAKALARPV
AGKTGTSNEAKDTWFAGYSTEIAAVVWVGYDDAKPLGSGETGGSTALPAWVALMKAAHEN
KPRAEFPRPPGVAVVSIDPKSGKRAPEGFEGAIDEVFLEGTEPSEADMAGADSGAGAADA
ATPPPTPASPPGSLTPPPEPDGVNL
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgagctctgccgcgccgggcgttcccaaaaacgtgcgcgcctcgtctcgtccgccggaa
gcaccccgcgagtccctgctctcccaggtcgtgggagcccccaagccgaagaccgacgat
tctcgccgcgcgaaggtcctccgcatcgccaagcgctgggcgatcggcctcggcatcgcc
gcggccgtgctggcgatgagcgcggccgtgacgggatggctgcttgtccgtcattacgaa
gcggatctgccgagcgtcgccgaactcgaacggggctatcacccctcgcaggtcacgcgc
gtgctcgcacgcgacggcacgttgctcgcggagctcttcaccgagcgacgcacggtcgtc
cgcatcgacgacttgcctccccaggtgaagctcgccgtcctcgccgccgaagacgcgaac
ttctacaaccacgaaggcatcaactacctcggcatcgcgcgcgcgttcgtggtcaacctc
cgcgcgggccgaacgcgtcagggtggttcgaccatcacccagcaggtgatcaagaacatc
ctgctcgacacgcaggagcgtacgtacaagcgcaagatgcgcgaggcactcctcgcccgg
cgcctcgagcaggagctttgcccgtcctgcgggtccgacgaggaaggcaagcgtcgccgc
aaggacaagatcctcgagctctatctcaatcacatctacttgggcggcggtcggtacggc
atcgaagaggcggccaagtacaacttcggcaagtcggcgcgcgagctcaccgtggccgag
gcggcgatgctcgccggcgttcctgccggccccgagatctattcgcccaagcgagatctg
aagcgcgccctctcgcgacgagagttcgtcctcggccagatgcgcgcgaagggcttcttg
aacgacgcgcagtacgaggccgcgaaagacgagcccgtacgcctgtcgccatcgcaggaa
gtcgagagtgagctagcgcccgaagccgtgacgctcgccaagaagcttctcttcgagctc
gagcccgatcgcggaccgcgcggcggcttcaccatcaccaccacgatcgacccgcacgta
caggccgccgcccgcaaagcgagtcgcgagaacgtgcaggcgtacgacaagcgccatggc
ctgctcgcgccgttcaaggccgcggcggtcgccagcaccaagggcaagaaggcgcccgcg
caggtgcccgttttcgagggcacgccgaacttcgaggcccacaaggttctcacgggcgcc
gtgatcggacacgacgacctgacgggcacgatcgacgtgcgtgtcggcaccgtcaccggc
tcgatcaagcttgcagattacaagcgttacaacccacagaacctggcgccgagccagttc
gccgaagtcggcgcgcgcctgcgcgtgagcctgctcgcaccggtcccgaccgagaagggt
gacggcgaaaccccgcacgagaaggcgatcgcgaacgccaaggttccgttgcgtctcgag
ctcgggcccgagacggcgagcgtcgtcgtcgacgtgcgcacgcgtcagatcctttcgatt
gtcggcagctacgagggaacgagcggcggtctcgatcgttcgtcgcaatcgcgacggcaa
cccggctcgaccttcaagccgatcgtctactcgtatgccatccacgcgcgccgctacacg
ccggcgagcctcatcgacatccagcccaccaccttcgccggcggttacaagccttcgaac
tacgagggctacgccggtagcgatccgcttcgccttcgcgaggtgctcgccaactccgtg
aacatcggcgcggtccgcgtgctcgaagacgtcggaccggcgagcgtcgtcgactgggcg
aaggccctcggcatcagctcggcgctcaagcccgatctctcgctcgccctcggatcgtac
gaggtccatcccagcgagctcgtcgcggcatacgcgaccttcgccgccggtggcatgtac
gaagagcctcgtctcgtgacgcgcatcgtcggccccgacggcaaagacgtcgccctcaag
gagccgcctcctccgcgccgtgtgctcgagcccgccgaggcctacgtgacgacgagcatg
ctccagagcgtcgtcgatcacggaacggccacgcgagcgaaggcgctggcccgccccgtg
gccggaaagaccggcaccagcaacgaggccaaagacacgtggttcgcgggatactcgacc
gagatcgccgcggtggtgtgggtcggttacgacgatgcaaagccgctcggatcgggagag
accggtggctcgacggcgcttccggcctgggtcgcgctcatgaaggcggcccacgagaac
aagccacgcgccgagttcccacgcccacccggcgtcgccgtcgtatccatcgatccgaag
agcggcaagcgcgcgcccgagggcttcgaaggcgcgatcgacgaggtgttcctcgaaggc
accgagccttcggaggccgacatggccggcgccgattccggtgccggagcagccgacgcc
gccacgcccccgcctacgccggcatcgccgccggggtcgctcacgcctccgccggagccg
gacggagtcaacctttga

DBGET integrated database retrieval system