KEGG   Labilithrix luteola: AKJ09_04332Help
Entry
AKJ09_04332       CDS       T04033                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
llu  Labilithrix luteola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AKU97668
UniProt: A0A0K1PVW4
LinkDB All DBs
Position
complement(4447777..4448925)
Genome map
AA seq 382 aa AA seqDB search
MTEHRVEKSESDEGRCFAYPGGVQLPFNPPLLPMLAKRVSDLPDDGDFIFEPKWDGFRAL
IFRDGDELFIQSRDEKGLDRYFPELAAPLKAQLPERCVLDGEVVIANGSKLDFEALQSRI
HPAASRVKMLAQEMPASVVFWDLIAEGDRDLRGLPFRERRARLQEILAKAEPPLHVTPAT
EDRAIASDWFSRFEGAGLDGVMAKPASGIYEPNKRSMFKVKHERECDCVVAGFRWHKDGE
GTAIGSLLLGLYDEAGQLQHVGVSASFTAEKRRAMVEFLAPYRENALDDHPWKHWAGDGS
EAGAPARMPGAKSRWSAKKDLSWQALRPELVVEVAYDHMQGTRFRHTAQFRRWRTDKKPA
DCNYAQLEVVAPHELAKIFAAH
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
ttgacggagcaccgcgtcgagaaaagcgagagcgacgaggggagatgttttgcgtaccct
ggcggcgtgcagctccctttcaatccgccccttctccccatgttggccaagcgcgtctcc
gacctcccggacgacggcgacttcattttcgagccgaagtgggatggctttcgcgcgctg
atcttccgcgacggcgacgagctcttcatccagagccgtgacgagaagggcctcgatcgc
tactttccggagctcgccgcgccactcaaggcccaacttcccgagcgctgtgtgctcgac
ggcgaggtcgtcatcgcgaacggctcgaagctcgatttcgaggcgctccagtcgcgcatt
catcccgcggcctcgcgcgtgaagatgctcgcgcaggagatgccggcgtcggtcgtcttc
tgggatctgatcgcggaaggtgatcgcgatctacgcggcctgcccttccgcgagcgccgc
gcgcgtctccaggagatcctcgcgaaggccgagccgccgctccacgtgacgcccgccacg
gaagaccgcgccatcgcctccgattggttctcgcgcttcgagggcgccgggctcgacggc
gtcatggccaagcccgcctcgggcatctacgagccgaacaagcgctcgatgttcaaggtg
aagcacgagcgcgagtgcgattgcgtggtggctggcttccgctggcacaaagacggcgaa
ggcaccgcgatcggctcgctcttgctcggtctctacgacgaggccggtcagctgcagcac
gtcggcgtctccgcgagcttcacggccgaaaagcgtcgcgcgatggtcgagttcctcgcg
ccgtatcgtgagaacgcgctcgacgatcacccgtggaaacactgggccggcgatggctcc
gaggccggtgcaccggcacgcatgccgggagcgaagagccgctggagcgcaaagaaggat
ctctcgtggcaggcgctgcgccccgagctggtcgtcgaagtcgcctacgatcacatgcaa
ggcacacgcttccggcacacggcgcagttccgtcgctggcgtaccgacaagaagcccgcc
gactgcaactacgcccagctcgaagtggtcgccccgcacgagctcgcgaagatcttcgcc
gcgcactga

DBGET integrated database retrieval system