KEGG   Labilithrix luteola: AKJ09_04848Help
Entry
AKJ09_04848       CDS       T04033                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
llu  Labilithrix luteola
Pathway
llu00010  Glycolysis / Gluconeogenesis
llu00053  Ascorbate and aldarate metabolism
llu00071  Fatty acid degradation
llu00280  Valine, leucine and isoleucine degradation
llu00310  Lysine degradation
llu00330  Arginine and proline metabolism
llu00340  Histidine metabolism
llu00380  Tryptophan metabolism
llu00410  beta-Alanine metabolism
llu00561  Glycerolipid metabolism
llu00620  Pyruvate metabolism
llu00625  Chloroalkane and chloroalkene degradation
llu00903  Limonene and pinene degradation
llu01100  Metabolic pathways
llu01110  Biosynthesis of secondary metabolites
llu01120  Microbial metabolism in diverse environments
llu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AKJ09_04848
   00053 Ascorbate and aldarate metabolism
    AKJ09_04848
   00620 Pyruvate metabolism
    AKJ09_04848
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AKJ09_04848
   00561 Glycerolipid metabolism
    AKJ09_04848
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AKJ09_04848
   00310 Lysine degradation
    AKJ09_04848
   00330 Arginine and proline metabolism
    AKJ09_04848
   00340 Histidine metabolism
    AKJ09_04848
   00380 Tryptophan metabolism
    AKJ09_04848
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AKJ09_04848
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    AKJ09_04848
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AKJ09_04848
Enzymes [BR:llu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     AKJ09_04848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AKU98184
UniProt: A0A0K1PYG4
LinkDB All DBs
Position
complement(5002843..5004240)
Genome map
AA seq 465 aa AA seqDB search
MGKIGEDRDPYTNELLVEIPLASVKDVDDAYRSAKRMQRQWASALPQERREVLSKAAKIF
ARRKDEIVDWLVREAGSTLIKANLEFELARQSIVEASSYPLHVEGRILPAGAPGKESRIY
RLPIGVVGVISPWNFPLQLSMRSVAPALALGNAVVLKPATETPVSGGLLIAKIYEEAGLP
AGVLSVIVGQGSDVGDAMVEHPIPRAISFTGSTTVGRRIGEKAGRAVKRVCLELGGNGPL
VVLDDADLDRAVDAAIAGKFLHQGQICMAVNRIVVDASQYDAFLDRFVERVVSLKVGDPA
LEGTVIGPLINQKQLTHVQKLVADTIAEGARLLVRGQPKGLVMPPVVLADVTNDMPAARE
EIFGPVAPVIRVEDEDEALRVANDTEYGLSAAVFTRDIERGVRFAERLESGMVHVNDSPV
NDEPNTAFGGEKASGLGRFGGEWAIAEFTTDRWISVQHEPRKYWF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggggaagattggggaggaccgcgacccgtatacgaacgagctcctggtcgagattcca
ctcgccagcgtgaaagacgtcgacgacgcgtatcgctctgccaagcgaatgcagcgccag
tgggcctcggcgctgcctcaagagcgtcgtgaagtgctctcgaaggcggcgaagatcttc
gcacgacgcaaagacgagatcgtcgattggctcgtccgtgaggcgggcagcacgctcatc
aaagcgaacctcgagttcgagctcgcgaggcagagcatagtcgaggcctcgagctatccg
ctgcatgtcgaggggcgaatcctgcctgcaggagcaccgggcaaagagagccgcatctat
cggctcccgatcggcgtcgtgggcgtgatcagcccctggaacttccccttgcagctgtcg
atgcgctcggtggctcccgcgctcgcgctcggcaacgccgtggtcctcaagccggccacc
gaaacgccggtgagcggcggcctgctcattgccaagatctacgaagaagcaggcctcccc
gcaggggttctgagtgtgatcgtcgggcaaggctcggacgtgggcgacgcgatggtcgaa
cacccgattccgcgcgccatctcgttcacgggcagcacgacggtcgggcgccgaatcggc
gagaaagccgggcgcgccgtcaaacgcgtgtgcctcgagctgggaggtaacggtcccctc
gtggtgctcgacgacgccgatctcgatcgcgctgtcgacgcagccatcgccgggaagttc
ctccatcaaggccagatctgcatggcggtcaaccgcatcgtcgtcgacgcctcgcagtac
gacgccttcctcgaccgcttcgtcgagcgcgtggtctcgctcaaggtcggcgaccctgcc
ctcgagggcacggtcatcgggccgctcatcaaccagaagcagctgacccacgtgcagaag
ctcgtggccgacacgattgccgaaggcgcgcgactgctcgtgcggggccaacccaaaggg
ctggtgatgccgcccgtggtcctcgccgacgtcaccaacgacatgccggcggcgcgcgaa
gaaatcttcggccccgtcgcccccgtcatccgtgtggaagacgaggatgaggctcttcgc
gtcgcgaacgacaccgaatacggactatccgccgccgtcttcacacgcgacatcgaacgc
ggagtccgatttgcggagcgtctcgagagcggcatggtccacgtcaacgactcgccggtg
aacgacgagccgaatacggccttcggcggagagaaggcatcgggcctcggtcgcttcggc
ggcgaatgggcaattgccgagttcaccacggatcgctggatatccgtgcaacacgagccc
aggaagtattggttctag

DBGET integrated database retrieval system