KEGG   Labilithrix luteola: AKJ09_05739Help
Entry
AKJ09_05739       CDS       T04033                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
llu  Labilithrix luteola
Brite
KEGG Orthology (KO) [BR:llu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AKJ09_05739
Enzymes [BR:llu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AKJ09_05739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Beta-lactamase2 RcnB Peptidase_S11
Motif
Other DBs
NCBI-ProteinID: AKU99075
UniProt: A0A0K1PZW4
LinkDB All DBs
Position
complement(5979078..5980241)
Genome map
AA seq 387 aa AA seqDB search
MLTLHWTRCASSKLAVLFALTASVSACTSETHHFDEATLDADLKAAQKTANVVGLLAEVQ
TPDGNVRARAGVAELGSNDPVPWDAVFRVASTTKTFTSVVVLQLVGEGKLSLEDSVDKWL
PGVVSGNGNDGAKITIRQLLQHTSGLFDYVMDSELQQAYVEDFERVCQDATPPEGLVAYG
LKHAPLFEPGTRWAYSNTNYVLLEMAIQKITGRSWADEVRQRIIGRLGLLHTYAMGFDPK
LPGPHAHSYFMIPNVPPIDATECSTMHTADSALISSTADLNAFFKALVRGELLRPQELAE
MQKTVEAPDDQFPNGRYGLGLQWTPLSCGGGYWHHAGDSPTGFHTRTGVTADGRRSVVIS
MSSTVDFLKTNAATAALTDHALCDAQE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgctcacactccattggacgcggtgcgcgagcagcaagcttgccgtcctcttcgcgctg
accgcatcggtctccgcgtgcaccagcgagacccatcacttcgatgaagcgacgttggat
gcagacctgaaagcagctcagaagacggcgaatgtcgtgggcctcttggccgaggtgcaa
accccggacggaaacgtgcgcgcacgggcaggcgtggcggagctcggcagcaacgatccg
gtcccctgggatgcggtgttccgcgtggcgagcacgaccaagaccttcacgtccgtcgtc
gtgcttcagctggttggtgaaggaaagctgtctctcgaggacagcgtcgacaagtggctc
ccgggggtcgtctcgggcaacggcaacgacggggcgaagatcacgatccgccagctgcta
cagcacacgagtggactcttcgactacgtcatggattccgagctgcagcaggcctacgtt
gaagacttcgagcgcgtctgccaagacgcgacgccgcccgaaggcctcgttgcctatggc
ctaaagcatgctccactcttcgagccgggcacgaggtgggcgtacagcaataccaactac
gtcctgctcgaaatggcgattcagaagatcacgggccgaagttgggcggacgaggtacgg
cagcggattatcggacggctcgggcttttgcatacctatgccatgggcttcgatccgaaa
ctcccgggcccgcatgcgcattcgtatttcatgattccgaacgttcccccgatcgacgcg
acggagtgcagcacgatgcacacggcggactccgcgctgatcagcagcaccgccgatctc
aatgcgttcttcaaagcgctcgtacgcggggagctgctccggccccaggagctcgccgag
atgcaaaagacggtggaggccccggatgatcagttcccgaacgggcggtatggtctcggg
ctgcaatggacgccgctctcgtgcggcggaggctattggcatcacgcaggggacagcccg
acgggctttcatacccgcacgggcgtcaccgccgatgggcgtcgcagcgtcgtgatctcc
atgagcagcacggtcgacttcctcaagaccaacgccgccaccgccgcactcaccgaccac
gcgttgtgcgatgcgcaggaatga

DBGET integrated database retrieval system