KEGG   Labilithrix luteola: AKJ09_05943Help
Entry
AKJ09_05943       CDS       T04033                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
llu  Labilithrix luteola
Pathway
llu00250  Alanine, aspartate and glutamate metabolism
llu00410  beta-Alanine metabolism
llu00430  Taurine and hypotaurine metabolism
llu00650  Butanoate metabolism
llu01100  Metabolic pathways
llu01110  Biosynthesis of secondary metabolites
llu01120  Microbial metabolism in diverse environments
llu02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AKJ09_05943
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AKJ09_05943
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AKJ09_05943
   00430 Taurine and hypotaurine metabolism
    AKJ09_05943
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AKJ09_05943
Enzymes [BR:llu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     AKJ09_05943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC HTH_23
Motif
Other DBs
NCBI-ProteinID: AKU99279
UniProt: A0A0K1Q1K5
LinkDB All DBs
Position
complement(6225877..6227271)
Genome map
AA seq 464 aa AA seqDB search
MPLHARSEVSTNINDDVYASTDLSVVMPKYKMAIYEHSAAHAYQVVHDELMLDGNARMNL
ATFCQTWSEPEVHKLMDECLDKNMIDKDEYPQTAELEARCVQMLADLWHAPEAADTMGCS
TTGSSEAAMLGGLALKWNWRKNRLAQKKSDAKPNLVCGPVQICWHKFARYFDVELRQIPL
EPGQIGMTAKQIAQYCDENTIGVVPTLGVTFTLQYEPVEQINRALDEIQKKTGLDIPIHV
DAASGGFIAPFLHEDVKWDFQLPRVKSINASGHKFGLTPLGCGWCVWREKSDLPEELIFN
VDYLGGNMPTFALNFSRPGGQTAIQYYNFLRLGREGYRKIHQACAETAKFLAEEIRKIGA
FDIVYDGIGGIPGVCWTLKKNGHPGNFTLYDIADRLRVRGWQVPAYPLPKNREDIIVQRV
LIRHGVSRDLAKILVDDIKASVGFFKGHPITTPLNEKEGTSYHH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgcacgcgcgcagcgaggtcagcacgaacatcaacgacgacgtgtacgcgtct
acggacctgtccgtcgtcatgcccaagtacaagatggcgatttacgagcacagcgcggct
catgcgtatcaggtcgtgcatgacgagctgatgctcgacggcaacgcgcgcatgaacctc
gccacgttctgtcagacctggtccgagccagaagtccacaagctcatggacgagtgcctc
gacaagaacatgatcgacaaggatgagtatccgcagaccgcggagctcgaggcgcgctgc
gtacagatgctcgccgatctctggcacgcaccggaggcggcggatacgatgggctgctcc
acgacggggtcgagcgaagcggccatgctcggcggcctcgcgctgaaatggaactggcgc
aagaaccgtctggcgcaaaaaaagtccgacgccaaaccgaatctcgtgtgcggcccggtg
cagatctgctggcacaagttcgcgcgctacttcgatgtcgagctgcgccagatccccctc
gagccgggtcaaatcggcatgacggcgaagcagattgcccagtattgcgacgagaacacg
atcggtgtcgttcccacgctcggcgtcacgttcacgctccaatacgaaccggtggagcaa
atcaatcgcgcgctcgacgaaatccagaagaagacgggcctcgacattccgattcacgtc
gacgcggcgagcggcggattcatcgcgccgttcctgcacgaggacgtgaaatgggatttc
cagctaccgcgcgtcaaatcgatcaatgcgtcgggtcacaagttcggtctcacgccgctc
ggatgcggctggtgcgtgtggcgcgagaaaagcgacctgccggaggagctgatcttcaac
gtcgactatctcggcggcaacatgccgaccttcgcgctgaacttctcgcgccccggcggc
cagacggccatccagtactacaacttcctccgcctcggtcgtgagggctatcgcaagatc
caccaggcctgcgccgagaccgcgaaattcctcgccgaggagatccggaagatcggcgcg
ttcgacatcgtctacgacggaatcggaggtattccgggcgtgtgctggacgctcaagaag
aacgggcacccgggcaacttcacgctctacgacatcgccgatcgcctccgcgtccgcggc
tggcaggttccggcctatccgctccccaagaaccgcgaagacatcatcgtgcagcgcgtg
ctgattcgtcacggcgtgagccgcgatctcgcgaagatcctcgtcgacgacatcaaggcg
tcggtcggcttcttcaaaggtcacccgatcacgacgccgctcaatgagaaggaaggcacc
agctaccaccactga

DBGET integrated database retrieval system