KEGG   Labilithrix luteola: AKJ09_08807Help
Entry
AKJ09_08807       CDS       T04033                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
llu  Labilithrix luteola
Pathway
llu00473  D-Alanine metabolism
llu00550  Peptidoglycan biosynthesis
llu01100  Metabolic pathways
llu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AKJ09_08807
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AKJ09_08807
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AKJ09_08807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:llu01011]
    AKJ09_08807
Enzymes [BR:llu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AKJ09_08807
Peptidoglycan biosynthesis and degradation proteins [BR:llu01011]
 Precursor biosynthesis
  Amino acid ligase
   AKJ09_08807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 RimK CPSase_L_D2 ATP-grasp ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AKV02144
UniProt: A0A0K1Q8S9
LinkDB All DBs
Position
9248001..9249011
Genome map
AA seq 336 aa AA seqDB search
MKKRRVGVLMGGTSAEREVSLRTGEGVARALEARGHEVARVVFGTEPVDKTLRDAKIDVA
FLALHGRGGEDGCIQGMLELLGIPYTGSSVLASALAMDKLKAKEMFRLHNIPTPPYYVAT
ESDLVELEELHGSFGFPVIVKPRGEGSSIGLTKAENMRELRLGIEAALEHDRCALVERYI
KATEVHVGILDGRVLGCIEVVPKSGLYDYAAKYTAGETDYILPPRIAPTRARGVMNLAER
AVRALGCTGAVRVDLLVTEGENEYVLEVNTLPGMTPTSLLPKIADHAGIDYGSLCEMILE
GADLHAGAHGERNAANRRRSGVTFKERDLSLVRKAV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagcggcgcgtgggggtgttgatgggcggtacgagcgccgagcgagaagtctcg
ctccggacgggcgaaggtgtcgcgcgtgccctcgaggcgcgtggtcacgaggtcgcccgc
gtcgtgttcggtaccgagccggtcgacaagacgcttcgtgacgcgaagatcgacgtcgcg
ttcctcgctctccacggccgcggtggcgaagacggctgcatccagggcatgctcgagctg
ctcggcattccctacaccggctcctcggttctcgcctcggcgcttgcgatggacaagctc
aaggcgaaggagatgttccgtctccacaacatcccgacgcccccctactacgtggcgacg
gagagcgacctcgtcgagctcgaagagctgcacggcagcttcggtttcccggtcatcgtg
aagccgcgcggcgagggctcctcgattggcctcaccaaggccgagaacatgcgcgagctg
cgcctgggcatcgaggcggcgctggagcacgatcgctgcgccctcgtcgagcgctacatc
aaggccacggaagtccacgtcggcatcctcgacgggcgcgttctcggctgcatcgaggtt
gtcccgaagagcggtctctacgactacgccgcgaagtacacggccggcgagaccgactac
atccttccgccgcgcatcgcgcccacgcgggcccgcggcgtcatgaacctcgccgagcgc
gcggttcgggccctcggctgcacgggcgccgttcgcgtcgacctgctcgtgacggaaggc
gagaacgagtacgtcctcgaggtcaacacgctccccggcatgaccccgacgtcgctcctt
ccgaagatcgccgaccacgcggggatcgattacggctccctctgcgagatgatcctcgaa
ggcgccgacctccacgcgggcgcgcatggcgagcgaaatgcggcgaatcgccgtcgctcg
ggcgtcaccttcaaggagcgcgacctctcgctggtgcgcaaagcggtctga

DBGET integrated database retrieval system