KEGG   Labilithrix luteola: AKJ09_08814Help
Entry
AKJ09_08814       CDS       T04033                                 

Definition
(GenBank) Beta-hexosaminidase
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
llu  Labilithrix luteola
Pathway
llu00520  Amino sugar and nucleotide sugar metabolism
llu01100  Metabolic pathways
llu01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    AKJ09_08814
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AKJ09_08814
Enzymes [BR:llu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     AKJ09_08814
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: AKV02151
UniProt: A0A0K1Q8L5
LinkDB All DBs
Position
complement(9256137..9257228)
Genome map
AA seq 363 aa AA seqDB search
MPSTSVLCGQLLVVGLAGTELEARETRALASGVRGGVVLFRRNIGPSMAGVAKLNASVQA
AMPEGVPALIAVDQEGGRVVRLGPPAMPLPPMRRLGDIGDTELLASTAEAHARELKALGF
TMSFAPVADVHTRPENPIIGDRAFAETPEAVARYAGAWADGLSRAGILTCAKHVPGHGDT
TVDSHLALPRVERARAELDRIEIAPFRALAQRPSIDAMMTAHVVYPALDAERPATLSHAV
CTDLIRRELGFQGVLFSDDLEMKAIAQPVSEAAVAAIAAGCDVLLVCSKWELAEEAHEAL
VREAEKSAAFRSRCEEAYGRALAMRTRAVPTPITDERALGAVFEATKPASVELERRLAAG
ASS
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgccctccacctccgtcctgtgtggccagcttctcgtggtcgggcttgccggcacggag
ctcgaggcccgcgaaacccgcgccctcgccagcggcgtccgcggcggagtcgtcctcttc
cgtcgcaacatcgggccttcgatggccggcgtggcgaagctcaacgcatccgtccaagcg
gccatgcccgaaggcgtcccggcgctgatcgccgtcgaccaggaaggcgggcgcgtcgtt
cgcctcggaccgccggcgatgccgcttcctccgatgcgccggctcggtgacatcggcgac
acggagctcctcgcgagcacggccgaagcgcacgcacgcgagctcaaagccctcggcttc
acgatgagcttcgcgcccgtcgccgacgtccacacgcgtcccgaaaatccgatcatcggc
gatcgcgcgttcgccgagacgcccgaggccgtcgctcgctacgcgggcgcatgggccgac
ggtctttcgcgcgccgggatcctgacgtgcgccaaacacgtgcccggccatggtgacacc
acggtcgactcgcatctcgcccttccccgcgtggagcgcgcgcgggcagagctcgatcgc
atcgagatcgcgccgttccgtgccctcgcccagcgcccgagcatcgacgccatgatgacg
gcccacgtcgtctaccccgccctcgacgccgagcgccccgccacgctttcgcatgcagtt
tgcacagatctaatccgccgcgagctcggtttccagggcgtgctcttctcggacgatctc
gagatgaaggcgatcgcgcagcccgtctccgaggccgccgtcgccgccatcgccgccgga
tgcgacgtgctgctcgtctgctcgaaatgggagctcgccgaagaggcccacgaagccctc
gtgcgcgaagccgaaaagagcgctgccttccgcagccgctgcgaagaagcctacggccga
gcgctcgccatgcgaacgcgcgcggtccccacgccgatcacggacgagcgcgcgctcggc
gccgtgttcgaagccacgaagcccgcaagcgtcgagctcgaacgacggcttgcggcagga
gcatcgtcatga

DBGET integrated database retrieval system