KEGG   Labilithrix luteola: AKJ09_08927Help
Entry
AKJ09_08927       CDS       T04033                                 

Definition
(GenBank) Trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
llu  Labilithrix luteola
Pathway
llu00500  Starch and sucrose metabolism
llu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AKJ09_08927
Enzymes [BR:llu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     AKJ09_08927
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     AKJ09_08927
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459 Cellulase
Motif
Other DBs
NCBI-ProteinID: AKV02264
UniProt: A0A0K1Q957
LinkDB All DBs
Position
complement(9386619..9390035)
Genome map
AA seq 1138 aa AA seqDB search
MTRTLAGSGTSRSRSARPVRGIADEPLWYKDAIIYECRTRSFFDSNGDGIGDLKGLSSKL
DYLADLGITALWLLPHYPSPGRDDGYDIAEYTDIHPDVGTLEDFDELVEKAHRRGIRVIT
ELVINHTSDAHAWFQRARRAPKGSPERDFYVWSDTAEKYKDARIIFRDFEPSNWTWDPVA
KQYFWHRFFSHQPDLNFENPALHEALFGVVDFWLARGVDGLRLDAIPYLFEEEGTNCENL
PQTHAFLKKLRAHIDEKWQGRMLLAEANQWPEDAAEYFGDGDECHMNFHFPIMPRLFMSI
HMEDRFPIIDILKQTPELHPTCQWAMFLRNHDELTLEMVTDEERDYMYRAYAHESQMRIN
LGIRRRLAPLTGNDRRKMELLNGLLFSMPGTPVLYYGDEIGMGDNVYLGDRNGVRTPMQW
SADRNAGFSRANPQRLILPIIIDPEYHYEALNVEAQQSNPNSLLWWTKRLIALRKRFRAF
GRGTVEFLQPSNPKVLAFIRSFEDETILVVANLSRHVQVVELDLAAMSGATPVEVMGGTR
FPAIGESPYMLTLGGHDFYWFSVEPAQPSVEEERLSLHGAITLLCTNVDELLFGSERPLL
EEALPAFLEARGWIDGTVSHVKVIDAVRVGSVELGTTPATEEPTTTPLVFVFARVDYAEG
GDAETFALPLVTVATEGRTVTPPAAAGTIVAHLHFQDVKGNATNGLLLEATSESVARALY
DTIAKGTTARGANGKVVASSTPGASLDEERRETRILTADRFGAVVAQGTYGVVKLCHRLE
EGSSPELENGRFLTTLAAPEKTPLETERARLTPRLLGQVEYRHGRTEASTIAMLEEFVQN
EGSAWEQARSELVRAFERVLARSAEEAAPVVPLRPVIELAYLEPPEAHRELIGTYRDWAK
LLGERLAQLHLALASSTDPNFEPHVYSTMDQRSTYQTARNMVGRTLVSLRRARPDLPTAI
RHSAEKVLSSEERILARFEPLLTQRIEAKQIRYHGDMHLGRALFTGKDFVIVGTGGGRDR
QPSERRRRGNALRDVASMIRSFHYAAATALRSLRPEDQEVAAAWSWIWQRWASAALLRGY
LDTAQHAPFMPKSTPLVSVLLEVSLMEKAFAELRTDLRGRPEMVWIPLQGILRMLGEE
NT seq 3417 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggacgctcgctggctccggaacgtcacgctcgcgaagtgctcgccccgtgcga
ggcatcgcggacgagccgctctggtacaaagacgcgatcatctacgaatgccgtacgcgg
tcgttcttcgacagcaatggcgacggcatcggtgatctgaaggggctatcgagcaagctc
gattacctcgccgacctcgggatcacggccctgtggctcttgccccactacccgtctccg
gggcgagacgacggctacgacatcgccgagtacaccgacatccatcccgacgtcggcacg
ctcgaagacttcgacgagctcgtcgagaaggcgcaccggcgaggcattcgggtcatcacc
gagctcgtcatcaaccatacgtccgacgcgcacgcatggttccagcgcgcacgacgcgcg
ccgaagggatcgcccgaacgcgacttctacgtgtggagcgacacggccgagaagtacaag
gacgcgcgcatcatcttccgggacttcgagccctcgaactggacgtgggatccggtcgcc
aagcagtacttctggcaccgcttcttctcgcaccagcccgatctcaacttcgagaatccc
gcgctccacgaggcgctcttcggcgtcgtcgatttctggctcgcgcgcggtgtcgacggt
ctccgcctcgacgcgattccgtatctcttcgaagaggaaggaacgaactgcgagaacctc
ccgcagacgcacgcgttcctgaagaagctgcgcgcccacatcgacgagaagtggcaaggc
cgcatgctcctcgcggaggcgaatcagtggcccgaagacgccgccgagtacttcggcgac
ggcgacgagtgccacatgaatttccacttcccgatcatgccgcgcctcttcatgtcgatt
cacatggaggaccggttccccatcatcgacatcctcaagcagacgcccgagctgcacccc
acttgccagtgggccatgttcttgcgcaaccacgacgagctcaccctcgagatggtgacc
gacgaagagcgcgactacatgtatcgcgcctacgcgcacgaatcgcagatgcgcatcaac
ctcggcatccgccgaaggctcgcgccgcttaccggcaacgatcgacgcaaaatggagctc
ctgaatgggctcctcttctcgatgcccggcacgcccgtcctctactacggcgacgagatc
ggcatgggcgacaacgtctacctcggcgatcgcaacggcgtacgtacgcccatgcagtgg
agcgcggaccgcaacgcgggcttctcgcgcgcgaacccgcagcgactcatcctgccgatc
atcatcgaccccgagtaccactacgaggcgctcaacgtcgaagcgcagcagtcgaacccc
aactcgctcctttggtggacgaagcgcctcatcgcgctgcgaaagcggttccgcgcgttc
ggacgaggcaccgtcgagttcctccagccgtcgaacccgaaggtcctcgcgttcatccgg
agcttcgaagacgagacgatcctcgtcgtggccaacctctcgcgccacgtgcaagtcgtc
gagctcgacctcgccgcgatgagcggcgccacgcccgtcgaagtcatgggcggcacgcgc
ttccccgccatcggcgaatcgccctacatgctgacgctcggcggtcacgacttctactgg
ttcagcgtcgagcccgcgcagcctagcgtggaggaagagcgcctcagcctgcacggcgcc
atcacgctgctctgcacgaacgtcgacgagctcctcttcggctcggagcgcccgctgctc
gaagaggcccttcccgcgttcctcgaggcgcgcgggtggatcgacggcaccgtctcgcac
gtcaaggtgatcgatgcggtgcgcgtgggaagtgtcgagctcggcaccaccccagccacg
gaagaaccgaccaccacgccgctcgtgttcgtgttcgcgcgcgtcgactatgccgagggc
ggagacgcggagacgttcgcgctcccgctcgtgacggtggcgaccgaaggtcgaacggtg
acgccgcccgcagcggcaggcaccatcgtcgcccaccttcatttccaggacgtgaagggc
aacgccacgaacggccttctcctcgaagccacgagtgaaagtgtggcgcgcgcgctctac
gacacgatcgcgaagggcacgacggcgcgcggcgcgaacggcaaggtcgtcgcgtcgtcg
acgccaggcgcgtctctcgacgaggagaggcgcgagacgcgcattctcacggccgaccgc
ttcggtgccgtcgtcgcgcaaggcacctacggggtcgtcaaactctgtcaccgcctcgag
gaaggctcgtcgccggagctcgagaacggacgattcctgacgacgctcgcggcccccgag
aagacgccgctcgaaaccgaacgcgctcggctcaccccgcgcctgctcggccaggtcgag
taccgtcatggacgcaccgaggcgtcgaccatcgcgatgctcgaagagttcgtgcagaac
gaaggctccgcgtgggagcaagcgcggtcggagctcgtccgcgcgttcgaacgcgtgctt
gcgcgatcggccgaagaagcggcgcccgtggttccgctgcgtccggtgatcgagctcgcc
tacctcgagccgcccgaagctcaccgcgagctcatcggcacgtatcgcgattgggccaag
ctcctcggggagcgtctcgcccagctccatctcgccctcgcctcgtcgacggacccgaat
ttcgagccccacgtgtactcgacgatggatcagcgctcgacgtaccagacggcgcgcaac
atggtcggacgcaccctcgtctcgctccggcgtgcgcgccccgatctaccgacggcgata
cgccactcggccgaaaaggtgctctcgagcgaggagcgcattcttgcgcgcttcgagccg
cttctcacgcagcgcatcgaagccaagcagattcgctaccacggtgacatgcacctcggt
cgcgcactcttcaccggcaaggacttcgtcatcgtcggtaccggtggaggccgcgaccgt
cagccctccgagcgacgacgacgcggcaatgccctccgcgacgtggcgagcatgattcgc
tccttccactacgcggcggccacggcactccgttcgcttcgccccgaggatcaggaagtt
gccgccgcctggagctggatctggcagcgctgggcctcggcagctctcctgcggggctac
ctcgacacggcgcagcacgctccgttcatgccgaagagcacgccgctggtgtccgttctc
ctcgaggtctccctcatggagaaggccttcgccgagctcagaaccgaccttcggggaaga
cccgagatggtctggatccccctccagggcatcctgcgcatgctgggcgaagagtag

DBGET integrated database retrieval system