KEGG   Labilithrix luteola: AKJ09_09259
Entry
AKJ09_09259       CDS       T04033                                 

Definition
(GenBank) Phosphoenolpyruvate-protein phosphotransferase of PTS system
  KO
K08483  phosphoenolpyruvate-protein phosphotransferase (PTS system enzyme I) [EC:2.7.3.9]
Organism
llu  Labilithrix luteola
Pathway
llu02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:llu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    AKJ09_09259
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:llu02000]
    AKJ09_09259
Enzymes [BR:llu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.9  phosphoenolpyruvate---protein phosphotransferase
     AKJ09_09259
Transporters [BR:llu02000]
 Phosphotransferase system (PTS)
  Enzyme I and HPr
   Enzyme I [TC:8.A.7]
    AKJ09_09259
SSDB
Motif
Pfam: PEP-utilizers_C PEP-utilisers_N PEP-utilizers
Other DBs
NCBI-ProteinID: AKV02596
UniProt: A0A0K1Q9X7
LinkDB
Position
9742360..9744288
AA seq 642 aa
MTERRSSPPKGTPSAPSSGDVLERTPTSIPAAPSSSSSPSASPPSSFDLEPREPTTLKGI
AGSPGVAVGPALVLGDLRASFVRRHVHTAQVPGELERVHQAVGTAQKTLREVDSRIANTM
REATAILDVYQLMLQDPALHERIEKKISREKKCAEWAVSEAGEEIVAMFGSGGDERDAYI
LERRHDIEFVADRLLRALVGEDTPHAVRLDEPMIVVARDLSPADTASMVREPALAFVTSV
GTRTSHTSIMARALEIPAVVGVADAMQNIRTGDMLVVDGLTGQVFVHPSEATVRDARQRS
EQHLAFARRLLSARHKPCVTADNVPVALKANVELPAEAILAVDHGAQGIGLYRTEFLYID
RTTQPGEDEQYEVYRAIVEAVSPQPVTLRTFDIGGDKFASTFQLPAEMNPALGLRAVRLA
LKQPEVFLTQLRAMVRASAHGDVRIMVPMVASVHEMREVRRLLSQAIEQVKARGQAFEEH
IPLGMMIEVPAAAVMADVFAREAEFFSLGTNDLVQYALAIDRASQSLAAQASPFDPAILR
LIKFVTDTGANHKRAVSLCGAMASDPLAACLLVGLGLRELSMEAAAIPEIKEAIRRLTVE
EAEAIALRALACDSADAVEELLARELAPRLIDLLAGLADDVA
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgaccgagcggcgcagcagccctcccaaaggcacgccgagcgcgccctcttcgggcgac
gtgctcgagcgcacgccgacgtccattcctgctgcgccttcgtcgtcctcttccccctcg
gcttcgccgccgagctcgttcgacctcgagcctcgcgagccgaccaccctcaaagggatc
gccggctctccgggtgttgccgtcggccccgcgctcgtcctcggtgatctgcgcgcgtcg
ttcgtccgtcgtcacgtgcacacggcgcaggttcccggtgagctcgaacgcgtccaccag
gccgtcggaaccgcgcagaagacactccgcgaagtcgactcacgcatcgcgaatacgatg
cgcgaggccacggccatcctcgacgtctaccagctaatgctgcaggaccccgcgctccac
gagcgaatcgagaagaagatctcgcgcgagaagaagtgcgcggagtgggcggtgtccgaa
gcgggcgaagagatcgtcgccatgttcggcagcggcggtgacgagcgcgacgcctacatt
ctcgagcgccgccacgacatcgagttcgtggccgaccggcttctgcgggcgctcgtcggc
gaagatacgccccacgccgtccggttggatgagccgatgatcgtggtcgcgcgtgatctt
tcgccggccgatacggccagcatggtccgcgagcccgcgctcgctttcgtcacctcggtc
ggaacgcgcacgagccacacgtcgatcatggcgcgtgcgctcgagatccccgcggtcgtc
ggcgtggcggacgcgatgcagaacatccgcaccggcgacatgctcgtcgtcgacggcctg
accggtcaggtcttcgtccatcccagcgaagccacggttcgcgacgcacgccagcggtcc
gagcagcacctcgcattcgcgaggcgcctgctctcggcgcgtcacaagccgtgcgtgacg
gcggacaacgtcccggtcgcgctgaaggcgaacgtcgagctacccgccgaagcgattctc
gcggtcgatcacggcgcgcagggcatcggcctgtaccgcaccgagttcctctacatcgac
cgcaccacgcaacccggcgaagacgagcagtacgaggtctatcgcgcgatcgtcgaggcc
gtgagcccgcagccggtcacgttgcgcacgttcgacatcggcggcgacaagttcgcgagc
accttccagttgcccgcggagatgaaccctgccctcggccttcgcgccgtgcgtctcgcg
ctcaagcagcccgaggtattcctcacgcagctccgggccatggtgcgtgcaagcgcccat
ggcgacgtgcgcatcatggttcccatggtcgcgagcgtccacgagatgcgcgaggtgcgc
cgcttgctctcccaggccatcgagcaggtcaaagcgcgcggccaagccttcgaagagcac
attcccctcggcatgatgatcgaggtgccggcggcggccgtcatggccgacgtcttcgcg
cgcgaggcggagttcttcagcctcggcacgaacgacctcgtgcaatacgccctcgcgatc
gaccgtgcgagccagtcgctcgccgcccaggcttcgccgttcgacccggcgatcttgcgg
ctcatcaagttcgtcaccgacacaggcgcgaaccacaaacgtgcggtctcgctctgtgga
gcgatggcgtcggatccgctcgcggcgtgtctgctcgtcggcctcggcctgcgcgagctg
tcgatggaagcggcggcgattccggagatcaaagaggccattcgacgtctcacggtcgaa
gaggccgaggcgattgctttgcgcgcactcgcttgcgacagcgccgacgccgtcgaggag
ctcctcgcacgcgagctcgcgccgcgcctcatcgacctgctcgccggtctcgccgacgac
gtggcctga

DBGET integrated database retrieval system