KEGG   Labilithrix luteola: AKJ09_10217Help
Entry
AKJ09_10217       CDS       T04033                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
llu  Labilithrix luteola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Pkinase_fungal RIO1 Seadorna_VP7
Motif
Other DBs
NCBI-ProteinID: AKV03554
UniProt: A0A0K1QCS5
LinkDB All DBs
Position
10793407..10795047
Genome map
AA seq 546 aa AA seqDB search
MSQPAPRVDPSESAVLHALDASDPRLGETLGKYRLVGALGHGGMADVYLAVADGPEGFRK
LCVLKMLKDEMAQDEDFRAMFLDEARLAARLNHPNVVQTFESGETQGRLMLAMEYVEGQP
VSRLRRRLSSEQFMLAAHASVLCDVLEALSYAHGLTDFDGSNLGIVHRDVSPHNILVGYD
GRVKLVDFGIAKSAAAMQMTQAGVLKGKIGYMAPEQASLLDVDGRADIFSVGVILWEAIA
GRRLADGLSASDVLVRRVEGREPKIAEVVPDVDPELAAMCDRAMHRDPAHRYASAADFQT
ELERWLAKHGAPSRKLWAKALRDAFAPEREQLRALVEHRLADSSGMRQSVRVGAAPSRAQ
LVAPDVTGGERALNGPETLRTPSGSTRNVLAPEDGGPTPAAPGETASIPARTVSLTPPPR
RRSSIGIVAAVATIVVLGSGTIGYVVSSRRNVQESPRAAATSLPVAHEPEPPPAASPPTT
PTVPSASPVTVTTIAQAVRPVYAPPQFKPPATNTRSPATPSVTTPHAPPPQKTPSRPLDE
KDPYAP
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacccgcgcccagagtcgatccgtcggagtcggccgtcctgcacgcgctggac
gcgagcgaccctcgcctcggtgagacgctcggcaaataccggttggtcggcgccctcggt
cacggcggcatggccgacgtctaccttgccgtcgccgacggccccgaaggtttccgcaag
ctctgtgtcctcaagatgctgaaggacgagatggcgcaggacgaggatttccgcgccatg
ttcctcgacgaggccaggctcgccgcgcgcctgaaccacccgaacgtcgtgcagaccttc
gagagcggcgagacgcaaggtcgtctcatgcttgcgatggagtacgtggagggccagccg
gtcagtcggcttcggagacggctctcctcggagcagttcatgctcgccgcgcatgcgagc
gtcctctgcgacgtgctcgaagcgctcagctacgcgcacggcctcaccgatttcgacggc
tcgaacctgggcatcgtccatcgcgacgtcagcccacacaacatcctcgtcggctacgac
ggcagggtgaagctcgtcgacttcggcatcgcgaagagcgccgcggccatgcagatgacg
caagccggcgtcctcaagggaaagatcggatacatggcgcccgagcaggccagcctgctc
gacgtcgacggtcgcgctgacatcttctccgtgggcgtcatcctgtgggaggccatcgcg
ggccggcgcctcgccgacggtctcagcgccagcgacgtgctcgtgcgccgtgtcgaaggg
cgcgagccgaagatcgcggaggtcgtccccgacgtcgatccagagctcgcagcgatgtgt
gaccgtgcgatgcatagggatccggcgcatcgttacgcgagcgccgccgacttccagacc
gagctcgaacgatggctcgccaagcacggcgcgccgagccgaaagctttgggcgaaggcg
ctgcgtgacgccttcgcccccgagcgcgaacagctccgcgccctggtcgagcaccgtctc
gctgacagcagcggaatgcgccagtcggttcgcgttggcgcggcgccgagccgtgcgcag
ctcgtcgccccggatgtcaccggcggcgagcgggcactcaatggaccggagacgctccgc
actccatcgggctccacgcgtaacgtgctcgcgccggaggacggcggcccaacccccgcc
gcgccaggcgagaccgccagcattccggcacgtacggtctcactcaccccgccgccccgc
cgccgaagctcgatcgggatcgtcgcggccgtcgcgacgatcgtggtgctcggctcgggc
acgatcggttacgtcgtgagctcgcggcgcaacgttcaggagagcccgcgcgcggctgca
acgtcgctccccgtggcgcacgagcccgagccgcctcccgccgcgtcccccccgactacg
cccacggtcccgagcgcctcgccggtcaccgtaacgacgatcgcgcaagccgtgaggccc
gtctacgccccgccgcagttcaagcctcccgcaaccaacacgcgctcgccagcaacgccg
agcgtgaccactccgcacgcgcctccgccccagaaaacgccgtcgcgcccgctcgacgaa
aaggacccgtacgcgccatga

DBGET integrated database retrieval system