KEGG   Labilithrix luteola: AKJ09_10304Help
Entry
AKJ09_10304       CDS       T04033                                 

Definition
(GenBank) Transcriptional regulator, MarR family
Organism
llu  Labilithrix luteola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_34 Fe_dep_repress HTH_IclR PadR HTH_24 Penicillinase_R HxlR FeoC TrmB FtsK_gamma Dimerisation
Motif
Other DBs
NCBI-ProteinID: AKV03641
UniProt: A0A0K1QCY0
LinkDB All DBs
Position
complement(10895318..10895812)
Genome map
AA seq 164 aa AA seqDB search
MSPLSSDIKSDVDQVLEAIIYLYTESRRITKELARRADLTGPQLTVVKMLEQIGDMSLSE
LSDKIRAQNSTVTGIIDRMEREDLVKRERSKEDRRVVFIRLTAKGRELAREIPVEPMEIF
RSALESLSAQEMRDLMRIMTKLARRVKQQIVRHKVGDDTESEEA
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcccctcagctccgatatcaagagcgacgtcgatcaggtcctcgaggccatcatt
tacctctacacggagagccgtcgcatcacgaaggagctcgcgcgccgcgcggatctcacg
ggaccgcagctcaccgtggtgaagatgctcgagcagatcggtgacatgtcgctctccgag
ctctccgacaagatccgtgcacagaacagcacggtgacggggatcatcgatcgcatggag
cgcgaagatctcgtgaagcgagagcgctcgaaagaggatcgcagggtcgtcttcatccga
ctgaccgcgaagggccgcgagctcgcgcgcgagatccccgtcgagccgatggagatcttc
cgaagcgcgctcgagagcctcagcgcgcaggagatgcgcgacttgatgcgcatcatgacg
aagctcgcccgccgcgttaaacagcagatcgttcgtcacaaagtcggcgacgacaccgaa
tccgaggaggcgtga

DBGET integrated database retrieval system