KEGG   Labilithrix luteola: AKJ09_10397Help
Entry
AKJ09_10397       CDS       T04033                                 

Definition
(GenBank) Isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
llu  Labilithrix luteola
Pathway
llu00020  Citrate cycle (TCA cycle)
llu00480  Glutathione metabolism
llu01100  Metabolic pathways
llu01110  Biosynthesis of secondary metabolites
llu01120  Microbial metabolism in diverse environments
llu01130  Biosynthesis of antibiotics
llu01200  Carbon metabolism
llu01210  2-Oxocarboxylic acid metabolism
llu01230  Biosynthesis of amino acids
Module
llu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
llu_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:llu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AKJ09_10397
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AKJ09_10397
Enzymes [BR:llu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     AKJ09_10397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: AKV03734
UniProt: A0A0K1QDA6
LinkDB All DBs
Position
complement(10980589..10981980)
Genome map
AA seq 463 aa AA seqDB search
MSLRGRTTLLAADSLFQPAVSAWYAHRVNNSGGFPMSATPNGTPITMGSGNKLNVPDNPI
VPFIEGDGTGRDIWRASVRVFDAAVEKAYGGKRKIAWLEVLAGEKAFKQTNNWLPDETVE
AFRKYLVGIKGPLTTPIGGGIRSLNVALRQLLDLYVCLRPVRWFNGVPSPVKRPQDVDMV
IFRENTEDIYAGIEWEAKSPEVQKVLSFIEKEFPKDFKKIRFPGSAGIGLKPVSEEGTDR
LVRSAIKYALDNKRKSVTFVHKGNIMKFTEGAFMKWGYALAEKEFGDHVYTWGQWERTKE
AKGEEAANAEQKEQLAKGKILIKDAIADITLQQVLTRAKEFDVIATLNLNGDYLSDALAA
QVGGIGIAPGGNINYVSGHAIFEATHGTAPKYADLDKVNPGSVVLSGEMMLRHMGWIEAA
DLIVKGMDGAIASKKVTYDFARLMEGATEIKCSEFGDNLIAHM
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
gtgagccttcgcgggcggacgacgttgctcgcggcggattcactcttccagccggccgtc
tcggcgtggtacgcccaccgcgtcaacaattctggaggttttccgatgtccgcgaccccg
aacggtacgcccatcacgatgggttctgggaacaagctgaacgtcccggacaacccgatc
gtccccttcatcgagggcgacggcaccggccgtgacatctggcgcgcgagcgttcgcgtg
ttcgatgctgcggtcgagaaggcgtacggcggcaagcgcaagatcgcgtggctcgaagtt
ctcgccggcgagaaggcgttcaagcagaccaacaactggctccccgacgagacggtcgag
gcgttccgcaagtacctcgtcggtatcaagggaccgctcaccacgccgatcggcggcggt
atccgctcgctgaacgtcgcgcttcgtcagttgctcgatctctacgtctgccttcgcccc
gtgcgctggttcaacggcgtgccgagccccgtcaagcgtccccaggacgtcgacatggtg
atcttccgcgagaacacggaagacatctacgcgggcatcgagtgggaggcgaagagcccc
gaggtccagaaggtcctctcgttcatcgagaaggagttcccgaaggacttcaagaagatc
cgcttcccgggctcggccggcatcggcctcaagccggtcagcgaggaaggcaccgaccgc
ctcgtccgctcggccatcaagtacgccctcgacaacaagcgcaagagcgtcacgttcgtc
cacaagggcaacatcatgaagttcaccgaaggtgccttcatgaagtggggctacgcgctc
gccgagaaggagttcggcgaccacgtctacacgtggggccagtgggagcgcacgaaggaa
gccaagggcgaggaagccgccaacgccgagcagaaagagcagctcgcgaagggcaagatc
ctcatcaaggacgcgatcgcggacatcacgctccagcaggtcctcacgcgcgccaaggag
ttcgacgtcatcgcgacgctgaacctcaacggcgactacctctcggacgcgctcgcggcg
caggttggcggcatcggcatcgcgccgggcggcaacatcaactacgtctcgggccacgcg
atcttcgaggcgacccacggcaccgcgccgaagtacgccgacctcgacaaggtcaacccg
ggtagcgtcgttctctcgggcgagatgatgctccgccacatgggctggatcgaagccgcc
gacctcatcgtcaagggcatggacggcgcgatcgcgagcaagaaggtcacctacgacttc
gctcgcctcatggaaggcgcgaccgagatcaagtgcagcgagttcggcgacaacctcatc
gcgcacatgtga

DBGET integrated database retrieval system