KEGG   Labilithrix luteola: AKJ09_11323Help
Entry
AKJ09_11323       CDS       T04033                                 

Definition
(GenBank) Peptidyl-dipeptidase A precursor
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
llu  Labilithrix luteola
Brite
KEGG Orthology (KO) [BR:llu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:llu01002]
    AKJ09_11323
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:llu04147]
    AKJ09_11323
   04090 CD molecules [BR:llu04090]
    AKJ09_11323
Enzymes [BR:llu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AKJ09_11323
Peptidases [BR:llu01002]
 Metallo Peptidases
  Family M2
   AKJ09_11323
Exosome [BR:llu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AKJ09_11323
CD molecules [BR:llu04090]
 Proteins
  AKJ09_11323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: AKV04660
UniProt: A0A0K1QGU8
LinkDB All DBs
Position
complement(11954133..11956061)
Genome map
AA seq 642 aa AA seqDB search
MKLKHRLFASLAPVIALAACGGGEPSPQVPSSTVASGSQPTTTPSAPATAEEAKKFVAQV
DKELRHLWIARDSAGWVNQNFITDDTEALSAAGEEATAAYVSEAIQKARRFDGVQGIDPD
TQRQLLLLKLAQVVPAPSNAAEREELAKLQSEMTATYGKGKYCPPEGHLMAWRTKDADGK
PLNPPKACLNLDDLSRIIKKSRNEAELLEAWKGWHSIAPAMKDKYARYAELGNKGAKEIG
FADMGALWRSGYDMTPEAFEADIERLWQDVKPLYDDLHCYTRKKLRAKYGKDKIPDKAPI
PAHLLGNMWAQEFNNVYDLVEPYPGQGSLDVDKKLKDKRYDATKMVKLGESFFTSLGLDA
LPKTFWERSLFTRPKDRDVVCHASAWDVTWNDDLRIKMCIEPTEDDLITIHHELGHDYYF
HYYYKLPTLFQAGANDGFHEGIGDTLALSVTPEYLKNIGLLDAVPQGDKGKLNFQMKMAL
DKVAFLPFGLLIDKWRWDVLNGKTPKDKYNEAWWALRTKYQGVAAPAPRSEADFDPGAKF
HVPASTPYVRYFLARIYQFQFHRALCKAAGFTGPLDQCSIYGNKEAGKKLRAMLELGQSK
PWPEALAVLSGEKKADAGAMLEYFAPLRAWLKDQNKGEQCGW
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
gtgaagctaaagcaccgacttttcgcgtccctcgctcccgtcatcgcgcttgccgcctgc
ggtggtggcgagccttcgccccaggtgccgtcttcgaccgtcgcgagcggttcgcagccg
accacgacgccgtccgctccggcgacggcggaggaggcgaagaagttcgtcgcgcaggtc
gacaaagagctccgtcacctgtggatcgcgcgcgatagcgcgggttgggtgaaccagaac
ttcatcaccgacgacaccgaggcgctctccgccgccggcgaagaggcgacggccgcgtac
gtgagcgaggcgatccagaaggcgcgtcgcttcgacggcgttcagggcatcgatcccgac
acgcagcgtcagcttcttctcctcaagctcgcccaggtcgtcccggctccttcgaacgcc
gcggagcgtgaggagctcgccaagctgcagagcgagatgacggcgacctacggcaagggc
aagtactgcccgccggaaggccacctcatggcgtggcgcacgaaggacgccgacggcaag
ccgctcaacccgccgaaggcgtgcctcaacctcgacgatctctcgcgcatcatcaagaag
agccgcaacgaagcggagctcctcgaggcctggaagggctggcactccatcgcgccggcc
atgaaggacaagtacgcgcgctacgcggagctcgggaacaagggcgccaaggagatcggc
ttcgcggacatgggcgcgctctggcgctccggttacgacatgacgcccgaagccttcgag
gcggacatcgagcgcctctggcaggacgtcaaaccgctctacgacgatctccactgctac
acgcgcaagaagctccgcgcgaagtacggcaaggacaagatccccgacaaggcgccgatc
cccgcgcacctgctcggcaacatgtgggcgcaggagttcaacaacgtctacgacctcgtg
gagccgtaccccggccagggctcgctcgacgtcgacaagaagctgaaggacaagcgctac
gatgccaccaagatggtgaagctcggcgagtcgttcttcacctcgctcggtctcgacgcg
ctcccgaagacgttctgggagcgttcgctgttcacgcgcccgaaggatcgcgacgtggtc
tgtcacgcgagcgcgtgggacgtcacctggaacgacgacctgcgcatcaagatgtgcatc
gagccgaccgaggacgatctcatcacgatccaccacgagctcgggcacgactactacttc
cactactattacaagctccccacgctctttcaggcgggcgcgaacgacggcttccacgag
ggcatcggtgacacgctcgctctcagcgtcacccccgagtacctgaagaacatcggtctg
ctcgacgcggttccgcagggcgacaagggcaagctgaacttccagatgaagatggccctc
gacaaggtcgccttcctcccgttcggccttctcatcgacaagtggcgctgggacgtcctc
aacggcaagacgccgaaggacaagtacaacgaggcctggtgggcgcttcgcaccaagtac
cagggcgttgctgctcccgcgccgcgctccgaggcggacttcgatccgggcgcgaagttc
cacgtgccggccagcacgccgtacgtgcgctacttccttgcgcgcatctaccagttccag
ttccaccgcgcgctctgcaaggcggctggcttcaccggcccgctcgaccagtgctcgatc
tacggcaacaaggaagcgggcaagaagctccgcgccatgctcgagctcggtcagagcaag
ccgtggcccgaagccctggcggtgctctccggcgagaagaaggccgacgcgggcgcgatg
ctcgagtacttcgcgccgctccgtgcgtggctgaaggatcagaacaagggcgagcagtgc
ggttggtga

DBGET integrated database retrieval system