KEGG   Lactococcus lactis subsp. cremoris KW2: kw2_0153Help
Entry
kw2_0153          CDS       T02848                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
llw  Lactococcus lactis subsp. cremoris KW2
Pathway
llw00220  Arginine biosynthesis
llw00250  Alanine, aspartate and glutamate metabolism
llw00290  Valine, leucine and isoleucine biosynthesis
llw01100  Metabolic pathways
llw01110  Biosynthesis of secondary metabolites
llw01130  Biosynthesis of antibiotics
llw01210  2-Oxocarboxylic acid metabolism
llw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:llw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    kw2_0153
   00290 Valine, leucine and isoleucine biosynthesis
    kw2_0153
   00220 Arginine biosynthesis
    kw2_0153
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:llw01007]
    kw2_0153
Enzymes [BR:llw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     kw2_0153
    2.6.1.66  valine---pyruvate transaminase
     kw2_0153
Amino acid related enzymes [BR:llw01007]
 Aminotransferase (transaminase)
  Class I
   kw2_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGV72140
UniProt: T2F245
LinkDB All DBs
Position
149470..150684
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVISDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYLCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaagtttgaaaaatcgcataaacttgataatgtcagctatgatattcgtggtcca
gtgcttgatgaagcacagcgtatgcgagccaatggtgaaaaaattcttcggttgaataca
ggaaatccagcagaatttggttttcttgccccagacgaagtgattagcgatttgattcag
catgctgtggatagcgaaggctattcagattctaaaggtattttctcggctcgtaaggcg
attatgcaatactgtcaacttaaaggattccctaatctggatatcaatgacattttcact
ggtaacggtgtttctgaattaatcgttatggctatgcaaggccttttggatactggtgat
gaggttttgatccctatgcctgattatccgctctggacggcttctgtcagcttagctggg
ggaacagcggttcactatctctgcgatgaacaagctggatggtttccggatattgatgat
attcgctcaaaaattactagtaatactaaagccattgttttaattaatcctaataatcca
acgggcgcgctgtattctaaagatttattacttgaaattgtccaagtggctagagaaaat
aatttaattatcttttcggatgagatttatgaccgtttggtcatggacggcgctgttcat
gttccgattgccagcttagcacctgacctttttgtggtcacaatgaatggactttccaag
tcacatcgtattgctggatttcgtgtgggctggatggttctgtcaggtgagaaatcgcat
gtcaaaggctatatcgaaggcttgaacatgctcgcttcaatgagactttgttcaaatgtt
ttagctcagtctgttgtgcaaacctcacttggtgggactcaatctgttgataagctgctt
ttgccaggtggacgagtttatgaacaaagagaattcatttataaagccattaatgatatt
ccaggattatctgccgtgaagccacaagctgctttctatattttccctaaaattgacaga
gaaatgtataaaattgataatgatgaacaatttgttttagactttttaaaacaggaaaag
atacttcttgttcatggtcgaggattcaattggaaagatcctgatcattttcggattgtc
tatctgcctcgtgtagatgaactggcggaaatacaggaaaaaatggaacgctttttatgg
cagtatcgtaaataa

DBGET integrated database retrieval system