KEGG   Lactococcus lactis subsp. cremoris KW2: kw2_0852Help
Entry
kw2_0852          CDS       T02848                                 

Definition
(GenBank) glycosyl transferase GT2 family
Organism
llw  Lactococcus lactis subsp. cremoris KW2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_2 Glyco_tranf_2_4 Chitin_synth_2 CAP59_mtransfer vMSA
Motif
Other DBs
NCBI-ProteinID: AGV72812
UniProt: T2F5M0
LinkDB All DBs
Position
873681..875009
Genome map
AA seq 442 aa AA seqDB search
MISFFQTGNGIVDLILTIMFLILVTYPILGGFAWFIGVLCYSFLFKYKQKSWDEIPVEVE
PFVTIMVPAHNEEVVIEDTINYLMTKINYENYEVLVTDDGSTDRTPEILKNLQEKYAKLR
VVRIEKNKGKAHAFNIGLAFAKGKLILSNDADTVPEPDSLNRYINYFIRPDSTNISAVTA
NMDVQNRAKLIAKSQTVEFSSIVGIIKRTQLGVLGSIYAYSGANTMYRKDALVDVGLFRQ
DRATEDISIAWDHQMDGWLSLFAPQIMFFMEVPESLKMLYRQRKRWAKGGTEVWLTNFRK
VFLHPFDNIGRTIMFIDQTLSIIWSFFFWISSALFIYSMVYFALGGNLERIYHMLTMAFL
FVCFEMISGTFQLIASLIVDDRGRKVKYLLFAPLYMLFYWMMNALTIVTTFIPAVKTILG
LGSGTWKSPERKGIKVTNKKDK
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgattagcttttttcaaacaggtaatggtattgttgatcttattttgacaataatgttt
ttaatattggtcacctatcctatcttgggtggttttgcttggttcattggtgttttgtgt
tatagttttttgtttaaatataagcaaaaatcatgggatgaaattccagtagaagttgag
ccttttgtcacgattatggtcccagcccataatgaagaagttgtcattgaagatacaatc
aattatttaatgacgaaaattaattatgaaaactatgaagttttggttactgacgacggc
tcaacagatcgtacgccagaaattttaaaaaacttacaggaaaaatatgcaaaattacga
gtggttcgtattgaaaaaaataaaggaaaagcacatgcttttaatattggattggccttt
gcaaaaggaaaattgattctgagtaatgacgctgatacggttccagaacctgattctctc
aatcgttatatcaattattttattcgcccagactctaccaatatttcagctgtaacggct
aatatggatgttcaaaatcgggccaagttaatagcgaaatcacagacagttgagttctcc
agtattgtaggaattattaagcggactcaacttggtgtcttgggaagtatttatgcctat
agtggggcaaatacaatgtatcgtaaagatgctctggttgatgttggtttatttagacaa
gaccgagcaaccgaagatattagtattgcttgggatcatcaaatggatggttggttatca
ctttttgctcctcaaattatgtttttcatggaagttcctgaatccttaaaaatgctatat
cgccaaagaaaacgttgggctaagggtgggacagaggtatggttgacaaattttagaaaa
gttttcttgcatccttttgacaatatcggaaggactattatgtttattgaccaaacttta
agtattatttggtccttctttttctggatttcatcagcactatttatctactctatggtt
tattttgctttgggtggaaatctagagcgaatttatcacatgctgacaatggcttttctc
tttgtttgttttgaaatgatttctggaacttttcaattaattgcttctttaatcgttgat
gatcgtggccgaaaggttaaatatttactttttgctccgttatatatgcttttctattgg
atgatgaatgctttaacaattgtgacaacttttattccagcagtaaaaacgatacttggt
ttaggctctggaacttggaaaagtcctgaacgcaaaggaataaaagtgactaataaaaaa
gataagtaa

DBGET integrated database retrieval system