KEGG   Lactococcus lactis subsp. cremoris KW2: kw2_1250Help
Entry
kw2_1250          CDS       T02848                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
llw  Lactococcus lactis subsp. cremoris KW2
Pathway
llw00250  Alanine, aspartate and glutamate metabolism
llw00430  Taurine and hypotaurine metabolism
llw00650  Butanoate metabolism
llw01100  Metabolic pathways
llw01110  Biosynthesis of secondary metabolites
llw01120  Microbial metabolism in diverse environments
llw02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:llw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    kw2_1250
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    kw2_1250
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    kw2_1250
   00430 Taurine and hypotaurine metabolism
    kw2_1250
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    kw2_1250
Enzymes [BR:llw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     kw2_1250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AGV73208
UniProt: T2F5M9
LinkDB All DBs
Position
complement(1309275..1310675)
Genome map
AA seq 466 aa AA seqDB search
MLYGKENRDEAEFLEPIFGSESEQVDLPKYKLAQQSIEPRVAYQLVQDEMLDEGNARLNL
ATFCQTYMEPEAVKLMSQTLEKNAIDKSEYPRTTEIENRCVNMIADLWNASEKEKFMGTS
TIGSSEACMLGGMAMKFSWRKRAEKLGLDINAKKPNLVISSGYQVCWEKFCVYWDIEMRE
VPMDREHMSINLEKVMDYVDEYTIGVVGIMGITYTGRYDDIKALDNLIEEYNKQTDYKVY
IHVDAASGGLYAPFVEPELEWDFRLKNVISINTSGHKYGLVYPGVGWVLWRDKKYLPEEL
IFKVSYLGGELPTMAINFSHSASQLIGQYYNFVRYGFDGYKAIHERTHKVAMYLAEEIEK
TGMFEIMNDGSQLPIVCYKLKENSNLGWNLYDLADRLLMKGWQVPAYPLPKNLENEIIQR
LVIRADFGMNMAFNYVQDMQEAIDALNKAHILFHQEPENKTYGFTH
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgttatacggaaaagaaaatcgagatgaagcggagttcttggaaccaatttttggttcg
gaaagtgaacaagtggatttgcctaaatataaattagctcaacaatcaattgagcctcga
gtggcttatcagttagttcaagatgaaatgctagatgaagggaacgctcgtttaaatttg
gccacattctgtcaaacttatatggaacctgaagcagtcaagctgatgagtcagaccttg
gaaaaaaatgcgattgacaaatcagaatatccaagaacaactgaaattgaaaaccgttgc
gtcaacatgatcgctgacctttggaatgcgagtgaaaaagaaaaatttatggggacttcg
acaattggttcttcagaagcttgtatgcttgggggaatggctatgaagttttcttggcgt
aagcgagcagaaaaattaggcctagatattaatgcgaaaaagccaaacttagtcatttct
tctggttatcaagtttgctgggaaaaattctgtgtttattgggatattgaaatgagagaa
gtgccaatggatagagaacatatgtcaatcaatttggaaaaagtgatggattatgttgat
gaatatacgattggagtagtcggaattatggggattacttatactggtcgttatgatgat
atcaaagctttggataatttgattgaagaatataataaacagacagactacaaagtttat
attcacgtagatgctgcttcaggaggactttatgctccttttgttgagccagaacttgag
tgggatttccgtttgaaaaatgtcatttcaatcaatacttcaggacataaatatggttta
gtatatcctggtgtaggttgggtcttgtggcgtgacaaaaaatatttacctgaagagtta
atttttaaagtaagttatcttggaggagaattaccaacaatggcgattaatttttctcac
agtgcttctcaattaatcggtcaatactataattttgtacgttatggatttgatggatat
aaagctattcatgagagaacgcataaagtagccatgtatttagcagaagaaattgaaaaa
acaggaatgtttgagattatgaacgatgggtcacaattgccaattgtctgctacaaatta
aaagaaaattcaaatcttggttggaatctttatgatttggcagatcgtttattaatgaag
ggatggcaagtgcctgcttatccacttcctaaaaatttggaaaatgaaatcattcaacgt
ttagtaattcgagcagatttcgggatgaatatggcatttaactatgttcaagatatgcaa
gaagcaattgatgcactaaataaggctcatattctatttcatcaggaacctgaaaataaa
acatatggctttactcactaa

DBGET integrated database retrieval system