KEGG   Lactococcus lactis subsp. cremoris KW2: kw2_1349Help
Entry
kw2_1349          CDS       T02848                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
llw  Lactococcus lactis subsp. cremoris KW2
Pathway
llw00564  Glycerophospholipid metabolism
llw01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llw00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    kw2_1349
Enzymes [BR:llw01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     kw2_1349
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored GIDA Pyr_redox_2 Pyr_redox_3 HI0933_like Pyr_redox NAD_binding_8 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGV73307
UniProt: T2F718
LinkDB All DBs
Position
1422910..1424487
Genome map
AA seq 525 aa AA seqDB search
MSISRQKNIEYLKANPDDWDFIIIGGGATGLGVAVDAASRGYKTVLVEQSDFAKSTSSRS
TKLVHGGVRYLAQGDVSLVREALHERGRLARNAPHLVKNQKFIIANYKAWEQPFYSIGMK
MYDALAGKLNIGKSKIYSKKKVAEAIPQIKHEHLVGGVMYYDGQFDDARMAINLMQTATE
QGALLVNYVKVTELVKTNSKVSSVKLHDELSGESFELHGKAIINATGIFVDQIMSMDTKE
HKPSVRPSQGVHLIVDGSFLGGQDAIMVPKTSDGRVLFCVPWHNKVILGTTDTPLTEFVL
EPRPLEEEIDFILETAGQYLEKKPERKDVLTAYAGLRPLAAPKEGDGEKTKEISRSHKLF
TSESGLVTITGGKWTTYRQMAEETVDLAIKTSKLPEKKCITRTLKIHGAKETTERERQNW
LYVYGSDKGKILALQNEDSSLALPLHPKYEFTGSEVIWAVREEMAQTLDDVLARRIRALF
LDARIAKEMAPKVAQLMAKEMGKDEAWEKEQVESFLALADGYILK
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgtctatctctcgtcaaaaaaatattgaatatttaaaagcaaatcccgatgattgggac
ttcattattatcggtggtggagcaaccggacttggagttgcggttgatgccgcatcacgc
ggttataaaacagttctagttgaacaaagtgactttgcaaaatcaacttcaagccgctcg
acaaaacttgttcacggtggcgttcgctaccttgctcaaggagatgtcagccttgttcgt
gaggcattacatgaaagaggtcgccttgctcgcaacgctccccatcttgtaaaaaatcaa
aaatttatcattgctaattacaaagcttgggagcaacccttttatagcatcggaatgaaa
atgtatgatgctttggcaggtaaattgaatattggaaaatcaaaaatttattctaagaaa
aaagttgctgaagcaatccctcaaatcaaacatgaacatctcgtcggaggagtcatgtat
tatgacggacaattcgatgatgccagaatggctatcaaccttatgcaaactgccactgaa
caaggtgcgctactagttaattatgtcaaagtgactgagcttgttaaaacgaactcaaaa
gtatcttctgttaaacttcatgatgaactttctggcgaatcatttgaacttcacggaaaa
gccatcatcaacgctacaggaatctttgttgaccaaattatgtcaatggataccaaagaa
cacaaaccctctgttcgtccttcacaaggcgtccacctcattgttgacggctcatttctc
ggtggtcaagatgccatcatggttccaaaaacttctgacggtcgtgtcttgttctgtgtc
ccttggcataataaagtaatcttaggaacgacagatacacctcttacagaattcgtttta
gaacctcgaccccttgaagaagaaattgatttcatcttagaaactgctggtcaatattta
gaaaagaaacccgaacgtaaagatgttttaactgcttatgctggtttacgtccacttgct
gctcccaaagaaggcgatggcgaaaaaacgaaagaaatttcaagaagtcataaactcttc
acctctgaatcaggattggtcacaattactgggggaaaatggacaacttatcgccaaatg
gccgaagaaactgttgatttagcaatcaaaacctctaaacttcctgaaaaaaaatgtatc
actagaacattgaaaatacatggggccaaagaaacaactgaaagagaacgtcaaaactgg
ctctatgtttacggttctgataaaggaaagattttagctctccaaaatgaagactcttct
ttagccttacctcttcacccaaaatacgaatttacaggttctgaagtcatctgggctgtc
cgtgaagaaatggctcaaactctagatgatgttctcgctcgtcggattcgtgcacttttc
cttgatgcaagaattgccaaagaaatggctcccaaagtcgcccaactgatggcgaaagaa
atgggtaaagatgaagcatgggaaaaagaacaagttgagagcttccttgctttagctgat
ggttatattttaaaataa

DBGET integrated database retrieval system