KEGG   Lactococcus lactis subsp. cremoris KW2: kw2_1944Help
Entry
kw2_1944          CDS       T02848                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
llw  Lactococcus lactis subsp. cremoris KW2
Brite
KEGG Orthology (KO) [BR:llw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:llw01001]
    kw2_1944
Enzymes [BR:llw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     kw2_1944
Protein kinases [BR:llw01001]
 Serine/threonine kinases: Other
  Bacterial family
   kw2_1944
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA RIO1 Kinase-like APH Kdo DUF4366 FTA2 Haspin_kinase DUF4710 LapA_dom
Motif
Other DBs
NCBI-ProteinID: AGV73898
UniProt: T2F7P2
LinkDB All DBs
Position
complement(2027062..2028939)
Genome map
AA seq 625 aa AA seqDB search
MIQIGKIFADRYRIIKEIGRGGMANVYQGEDTFLGDRKVAIKVLRSNFENDDIAIARFQR
EAFAMAELSHPNIVGISDVGEFESQQYIVMEFVDGMTLKQYINQNAPLANDEAIEIITEI
LSAMDMAHSHGIIHRDLKPQNVLVSSSGTVKVTDFGIAKALSETSLTQTNTMFGSVHYLS
PEQARGSNATVQSDIYAIGIILFELLTGQIPFDGDSAVAIALKHFQENIPSIINLNPEVP
QALENVVIKATAKDINNRYADVEEMMTDVATSTSLDRRGEEKLVFNKDHDETKIMPANLI
NPYDTKPLIDKKTDDQEKAQSESSTTENNKNKNKKSKKGLIISLVVLLLVIGGGAFAWAV
STPTNVKVPNVTNNLTLDQAKKKIKAADLKVGTVHKQQSTTVAEGKVIKTDPASGATVRS
KSSVDIYVSSGNENIIKMKDFVGEKIDDAMATLLKDYGIDESQVVQTSVPSDSYAAGTII
KQTPKKGSSFDVTSGDKITFEVSSGKQIAIPSYTNQDAESYKAILKQAGFTNVTLNYIDT
PGSPTGWVFGVTPTVGELVSIDAPIVVKVTQAVEQSSSESSVSTSETSTSESTSASSSTT
SSSSSSTTEQSPENSTSSSTTTSHS
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatcggtaaaatctttgccgatcgttatcggattatcaaagaaatcggacgt
gggggaatggcaaacgtttatcaaggagaagatactttccttggtgatcgaaaagttgca
attaaagtacttcgttctaattttgaaaatgatgacattgcaatcgctcgttttcaaaga
gaagcttttgcgatggcggaactctctcatccgaatatcgtaggtatttctgacgtcggt
gaattcgaaagtcaacaatacattgtaatggaatttgttgatggtatgacgctcaaacaa
tacatcaaccaaaatgctcctctagctaatgatgaagccattgaaattattacagaaatt
ctatcagcaatggatatggctcattcacatggaattattcaccgtgatttaaaaccacaa
aatgttttagtttcaagtagtggaacggtaaaagtaacagatttcggaattgcaaaggcc
ctttctgaaacttcactcactcaaacaaatacgatgtttggctcagttcattatctatca
cctgaacaagcgcgtggttcaaatgctactgtacaatcagacatttatgccattgggatt
attttatttgagcttttaacaggtcaaataccttttgatggggattcagccgtagcaatt
gccctcaaacatttccaagaaaatattccaagcatcataaatctcaacccagaagttccg
caagcattggaaaatgtcgtcatcaaagcaacagcaaaagatatcaacaatcgatatgct
gatgttgaagaaatgatgacagatgtagctacttcgactagtcttgatcgacgtggggaa
gaaaaattagttttcaacaaggaccatgatgaaacaaaaatcatgcctgccaatctaatt
aatccttatgatactaagcctttgattgataagaaaacagatgatcaggaaaaagcgcaa
tcagaatcatcaactacagaaaacaataagaataaaaataaaaagtctaaaaaaggattg
attatcagtcttgttgttctccttcttgtcattggtggtggagcctttgcatgggctgtt
tctacaccgacaaatgttaaggttcctaatgtgactaataacttaacattggatcaagcg
aagaaaaagattaaagcagctgatcttaaggtgggaacggttcataaacaacaaagcaca
accgttgcagaaggtaaagtgattaaaactgatccagcaagtggggctaccgtaaggtct
aaaagttctgttgatatttacgtttcatctggaaatgaaaatattatcaaaatgaaagac
tttgttggtgaaaaaattgatgatgcaatggccactctgcttaaagattatggtattgat
gaaagtcaagtggtccaaacctctgtccctagtgattcttatgccgcaggtacaatcatt
aaacaaacacctaaaaagggttctagttttgatgtgacaagtggtgataaaattacattt
gaagtttcaagtggaaaacaaattgccattccatcttacactaatcaggatgctgaaagc
tataaagcaattttgaaacaagctggcttcactaatgttactttaaactatattgatact
ccaggaagtccgacaggatgggtatttggagttactccaactgttggtgaattggtttcg
atagatgccccaattgttgttaaggttactcaggcagttgagcaatcatcctcagaatct
tctgtttctacatcagaaacatcaacttctgaatcaacatcagcttcaagctcaacaacg
agctcgtcttcttcaagtacaactgagcaatcgccagaaaattctacttcaagttcgaca
acaacatcacatagttaa

DBGET integrated database retrieval system