KEGG   Lactococcus lactis subsp. lactis NCDO 2118: NCDO2118_0083Help
Entry
NCDO2118_0083     CDS       T03437                                 

Gene name
aroF
Definition
(GenBank) Phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
llx  Lactococcus lactis subsp. lactis NCDO 2118
Pathway
llx00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llx01100  Metabolic pathways
llx01110  Biosynthesis of secondary metabolites
llx01130  Biosynthesis of antibiotics
llx01230  Biosynthesis of amino acids
llx02024  Quorum sensing
Module
llx_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:llx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NCDO2118_0083 (aroF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    NCDO2118_0083 (aroF)
Enzymes [BR:llx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     NCDO2118_0083 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: AII11584
LinkDB All DBs
Position
88857..89894
Genome map
AA seq 345 aa AA seqDB search
MSFKEISPKINIDAIKMLGHLNSEQQEKKLQRDKELEAIIKGEDDRLLLIIGPCSSDNEE
AVLEYARRLAKLQETVKDKIFMVMRVYTAKPRTNGDGYKGLIHEPDADGHTDLINGIKMV
RDLHYKVITETGLTTADEMLYPENLPMVDDLVSYHAIGARSVENQQHRFVASGIDVPTGL
KNPTSGNLKVMFNGIYAAQQSQDFLFGRAEVQTSGNPLAHAILRGGQDENGKYHPNYYTD
NLLDTIEIYEKMGLKNPFIVIDTNHDNSGKKFMEQIRIVRQTLVNRDWDDKIRQNVRGFM
IESYLEDGRQDKPEVFGKSITDPCLGWDKTEALVQEIYEAENKNN
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgagttttaaagaaataagtcctaagataaatattgatgcaattaagatgttgggacat
ctcaacagtgagcaacaagaaaaaaaattgcaacgggataaagaacttgaagcaattata
aaaggtgaagatgaccgtttactcttgattattgggccatgttcgtcagacaatgaagaa
gcagttttagaatatgctcgccgtttagctaaacttcaagaaacagttaaagataaaatt
tttatggtcatgcgtgtctatactgcaaaacctcgtacaaatggcgatggctataaagga
ttgattcacgaaccagatgctgatggtcataccgatttaatcaatggaatcaaaatggtt
cgtgacttacattacaaggtcatcactgaaactggtttgacaactgctgatgaaatgctt
tacccagaaaatcttccaatggtagatgatttggtcagctaccatgcaattggtgcacgt
tctgttgaaaatcaacaacaccgttttgttgcttctgggattgatgtgccaactggtttg
aaaaatccaacatcaggaaatttgaaagtgatgtttaatggaatttacgcggctcaacaa
tcacaagatttcctctttggtcgtgcagaagttcaaacatcaggaaatcctttagcacat
gcgattttgcgtggtggacaagatgaaaatgggaaataccatccaaactactacactgat
aacttgcttgatacaattgaaatttatgaaaaaatgggcttgaaaaatccttttattgtc
attgatacaaaccatgataactctggtaagaaatttatggaacaaatccgtattgttcgt
caaaccttagttaatcgtgactgggatgataaaattcgccaaaatgttcgtggcttcatg
attgaatcttacctagaagatggtcgccaagataaaccagaagtatttggtaaatcaatt
actgacccatgtttaggttgggataaaacagaagcacttgttcaagaaatttacgaagct
gaaaacaaaaataactaa

DBGET integrated database retrieval system