KEGG   Lactococcus lactis subsp. lactis NCDO 2118: NCDO2118_0150Help
Entry
NCDO2118_0150     CDS       T03437                                 

Gene name
aspC
Definition
(GenBank) Aspartate aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
llx  Lactococcus lactis subsp. lactis NCDO 2118
Pathway
llx00220  Arginine biosynthesis
llx00250  Alanine, aspartate and glutamate metabolism
llx00290  Valine, leucine and isoleucine biosynthesis
llx01100  Metabolic pathways
llx01110  Biosynthesis of secondary metabolites
llx01130  Biosynthesis of antibiotics
llx01210  2-Oxocarboxylic acid metabolism
llx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:llx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    NCDO2118_0150 (aspC)
   00290 Valine, leucine and isoleucine biosynthesis
    NCDO2118_0150 (aspC)
   00220 Arginine biosynthesis
    NCDO2118_0150 (aspC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:llx01007]
    NCDO2118_0150 (aspC)
Enzymes [BR:llx01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     NCDO2118_0150 (aspC)
    2.6.1.66  valine---pyruvate transaminase
     NCDO2118_0150 (aspC)
Amino acid related enzymes [BR:llx01007]
 Aminotransferase (transaminase)
  Class I
   NCDO2118_0150 (aspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AII11650
LinkDB All DBs
Position
154837..156051
Genome map
AA seq 404 aa AA seqDB search
MRKFEKSHKLDNVSYDIRGPVLDEAQRMRANGEKILRLNTGNPAEFGFLAPDEVISDLIQ
HAVDSEGYSDSKGIFSARKAIMQYCQLKGFPNLDINDIFTGNGVSELIVMAMQGLLDTGD
EVLIPMPDYPLWTASVSLAGGTAVHYFCDEQAGWFPDIDDIRSKITSNTKAIVLINPNNP
TGALYSKDLLLEIVQVARENNLIIFSDEIYDRLVMDGAVHVPIASLAPDLFVVTMNGLSK
SHRIAGFRVGWMVLSGEKSHVKGYIEGLNMLASMRLCSNVLAQSVVQTSLGGTQSVDKLL
LPGGRVYEQREFIYKAINDIPGLSAVKPQAAFYIFPKIDREMYKIDNDEQFVLDFLKQEK
ILLVHGRGFNWKEPDHFRIVYLPRVDELAEIQEKMERFLWQYRK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaatttgaaaaatcgcataaacttgataatgtcagctatgatattcgtggtcca
gtattggatgaagcacaaagaatgcgagccaatggtgaaaaaattcttcgattgaataca
ggaaatccagctgaatttggctttcttgctcctgatgaagtcattagtgacttgattcaa
catgctgtggatagcgaaggatattcagattctaaagggattttctcggctcgtaaagcg
attatgcaatactgtcagctcaagggttttcctaatcttgatatcaatgatattttcaca
ggtaatggggtttctgaattgattgttatggccatgcagggacttttggacacaggggat
gaggttttgattcctatgcctgattatccactttggacggcttccgtcagcttagctgga
ggaacagctgttcattacttctgtgatgaacaggctggttggttccctgacattgatgat
attcgctcaaaaatcacaagtaatacaaaagccattgttttgattaatcctaataatcca
acgggtgcgctgtattctaaagatttattgcttgaaattgttcaagtggctagagaaaat
aatttaattattttctctgacgaaatttatgaccgattggttatggatggagcagttcat
gttccgattgctagcttggcaccagatctttttgtggtcacaatgaatggcctctcaaaa
tcacaccgcattgcgggattccgcgtggggtggatggttctgtcaggtgaaaaatcacat
gtcaagggttatattgaaggtttgaatatgctggcttcaatgcgactttgttccaatgtt
ttagctcaatcagtcgtacaaacttcacttggtggcactcaatcagttgataaattgctg
ttgccgggtggacgagtttatgagcaaagagaattcatttataaagccatcaatgatatt
ccaggattatctgcggtcaaacctcaagcagctttctatattttccctaaaattgacaga
gaaatgtataaaattgataatgatgaacaatttgtcttggactttttgaagcaggaaaaa
atcctgcttgttcatggtcgaggatttaattggaaagagccagaccatttccgaattgtt
tatctgcctcgtgtggacgaattagcggaaatacaagaaaaaatggaacgtttcctttgg
caatatcgtaaataa

DBGET integrated database retrieval system